Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 800055..800239 | Replicon | chromosome |
Accession | NZ_CP077894 | ||
Organism | Staphylococcus aureus strain 329 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | KU540_RS03750 | Protein ID | WP_000482647.1 |
Coordinates | 800055..800162 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 800179..800239 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU540_RS03725 | 795419..795892 | + | 474 | WP_000456490.1 | GyrI-like domain-containing protein | - |
KU540_RS03730 | 796015..797226 | - | 1212 | WP_001191973.1 | multidrug effflux MFS transporter | - |
KU540_RS03735 | 797406..798065 | - | 660 | WP_000831298.1 | membrane protein | - |
KU540_RS03740 | 798125..799267 | - | 1143 | WP_001176872.1 | glycerate kinase | - |
KU540_RS03745 | 799535..799921 | + | 387 | WP_000779354.1 | flippase GtxA | - |
KU540_RS03750 | 800055..800162 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 800179..800239 | - | 61 | - | - | Antitoxin |
KU540_RS03755 | 800734..802473 | + | 1740 | WP_001064832.1 | ABC transporter ATP-binding protein | - |
KU540_RS03760 | 802522..804255 | + | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein | - |
KU540_RS03765 | 804486..804653 | + | 168 | WP_031785511.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T208444 WP_000482647.1 NZ_CP077894:800055-800162 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208444 NZ_CP103645:2076616-2076719 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT208444 NZ_CP077894:c800239-800179 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|