Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1647721..1648028 | Replicon | chromosome |
| Accession | NZ_CP077880 | ||
| Organism | Staphylococcus aureus strain 356 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | KU497_RS08335 | Protein ID | WP_011447039.1 |
| Coordinates | 1647852..1648028 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1647721..1647860 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU497_RS08290 (1642993) | 1642993..1643550 | - | 558 | WP_000528632.1 | PBECR4 domain-containing protein | - |
| KU497_RS08295 (1644186) | 1644186..1644371 | - | 186 | WP_001286805.1 | hypothetical protein | - |
| KU497_RS08300 (1644373) | 1644373..1644483 | - | 111 | WP_000139423.1 | hypothetical protein | - |
| KU497_RS08305 (1644554) | 1644554..1644706 | - | 153 | WP_001788502.1 | hypothetical protein | - |
| KU497_RS08310 (1644951) | 1644951..1645286 | - | 336 | Protein_1606 | SH3 domain-containing protein | - |
| KU497_RS08315 (1645937) | 1645937..1646428 | - | 492 | WP_000920038.1 | staphylokinase | - |
| KU497_RS08320 (1646619) | 1646619..1647374 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU497_RS08325 (1647386) | 1647386..1647640 | - | 255 | WP_000611512.1 | phage holin | - |
| KU497_RS08330 (1647692) | 1647692..1647799 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - (1647721) | 1647721..1647860 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1647721) | 1647721..1647860 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1647721) | 1647721..1647860 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1647721) | 1647721..1647860 | + | 140 | NuclAT_0 | - | Antitoxin |
| KU497_RS08335 (1647852) | 1647852..1648028 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| KU497_RS08340 (1648137) | 1648137..1648910 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| KU497_RS08345 (1649283) | 1649283..1649657 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| KU497_RS08350 (1649713) | 1649713..1650000 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| KU497_RS08355 (1650046) | 1650046..1650198 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / sea | 1642993..1687693 | 44700 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T208377 WP_011447039.1 NZ_CP077880:c1648028-1647852 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T208377 NZ_CP103633:221694-221801 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 140 bp
>AT208377 NZ_CP077880:1647721-1647860 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
