Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 675770..675952 | Replicon | chromosome |
| Accession | NZ_CP077880 | ||
| Organism | Staphylococcus aureus strain 356 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | KU497_RS03695 | Protein ID | WP_001801861.1 |
| Coordinates | 675857..675952 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 675770..675829 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU497_RS03680 | 674908..675285 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| KU497_RS03685 | 675479..675655 | + | 177 | Protein_685 | transposase | - |
| KU497_RS03690 | 675633..675734 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 675770..675829 | + | 60 | - | - | Antitoxin |
| KU497_RS03695 | 675857..675952 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| KU497_RS03700 | 676155..676298 | + | 144 | WP_001549059.1 | transposase | - |
| KU497_RS03705 | 676902..677285 | + | 384 | WP_000070812.1 | hypothetical protein | - |
| KU497_RS03710 | 677296..677472 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| KU497_RS03715 | 677474..677659 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| KU497_RS03720 | 677774..678415 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KU497_RS03725 | 678633..679184 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| KU497_RS03730 | 679282..679626 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| KU497_RS03735 | 679667..680293 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T208375 WP_001801861.1 NZ_CP077880:c675952-675857 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T208375 NZ_CP103633:220727-220834 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT208375 NZ_CP077880:675770-675829 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|