Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2490781..2490965 | Replicon | chromosome |
Accession | NZ_CP077872 | ||
Organism | Staphylococcus aureus strain 358 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | KU513_RS12445 | Protein ID | WP_000482650.1 |
Coordinates | 2490781..2490888 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2490905..2490965 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU513_RS12420 | 2486144..2486617 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
KU513_RS12425 | 2486740..2487951 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
KU513_RS12430 | 2488133..2488792 | - | 660 | WP_000831298.1 | membrane protein | - |
KU513_RS12435 | 2488852..2489994 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
KU513_RS12440 | 2490262..2490648 | + | 387 | WP_000779358.1 | flippase GtxA | - |
KU513_RS12445 | 2490781..2490888 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2490905..2490965 | - | 61 | - | - | Antitoxin |
KU513_RS12450 | 2491516..2493279 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein | - |
KU513_RS12455 | 2493304..2495037 | + | 1734 | WP_031833708.1 | ABC transporter ATP-binding protein | - |
KU513_RS12460 | 2495268..2495435 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T208342 WP_000482650.1 NZ_CP077872:2490781-2490888 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208342 NZ_CP103623:2690653-2690760 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT208342 NZ_CP077872:c2490965-2490905 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|