Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1985774..1985958 | Replicon | chromosome |
Accession | NZ_CP077867 | ||
Organism | Staphylococcus aureus strain 367 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | KU500_RS09480 | Protein ID | WP_000482647.1 |
Coordinates | 1985774..1985881 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1985898..1985958 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU500_RS09455 | 1981136..1981609 | + | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
KU500_RS09460 | 1981732..1982943 | - | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
KU500_RS09465 | 1983126..1983785 | - | 660 | WP_000831298.1 | membrane protein | - |
KU500_RS09470 | 1983845..1984987 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
KU500_RS09475 | 1985255..1985641 | + | 387 | WP_000779353.1 | flippase GtxA | - |
KU500_RS09480 | 1985774..1985881 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1985898..1985958 | - | 61 | - | - | Antitoxin |
KU500_RS09485 | 1985908..1986075 | + | 168 | WP_000301893.1 | hypothetical protein | - |
KU500_RS09490 | 1986529..1988292 | + | 1764 | WP_225805770.1 | ABC transporter ATP-binding protein | - |
KU500_RS09495 | 1988317..1990050 | + | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein | - |
KU500_RS09500 | 1990281..1990448 | + | 168 | WP_031845053.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T208281 WP_000482647.1 NZ_CP077867:1985774-1985881 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208281 NZ_CP103609:c4720572-4720465 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAATAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAATAA
Antitoxin
Download Length: 61 bp
>AT208281 NZ_CP077867:c1985958-1985898 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|