Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1057516..1057700 | Replicon | chromosome |
| Accession | NZ_CP077865 | ||
| Organism | Staphylococcus aureus strain 370 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | KU528_RS05440 | Protein ID | WP_000482647.1 |
| Coordinates | 1057593..1057700 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1057516..1057576 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU528_RS05420 | 1053026..1053193 | - | 168 | WP_031845053.1 | hypothetical protein | - |
| KU528_RS05425 | 1053424..1055157 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein | - |
| KU528_RS05430 | 1055182..1056945 | - | 1764 | WP_225805770.1 | ABC transporter ATP-binding protein | - |
| KU528_RS05435 | 1057399..1057566 | - | 168 | WP_000301893.1 | hypothetical protein | - |
| - | 1057516..1057576 | + | 61 | - | - | Antitoxin |
| KU528_RS05440 | 1057593..1057700 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| KU528_RS05445 | 1057833..1058219 | - | 387 | WP_000779353.1 | flippase GtxA | - |
| KU528_RS05450 | 1058487..1059629 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| KU528_RS05455 | 1059689..1060348 | + | 660 | WP_000831298.1 | membrane protein | - |
| KU528_RS05460 | 1060531..1061742 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
| KU528_RS05465 | 1061865..1062338 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T208272 WP_000482647.1 NZ_CP077865:c1057700-1057593 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208272 NZ_CP103609:c2837992-2837889 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT208272 NZ_CP077865:1057516-1057576 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|