Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 770743..770960 | Replicon | chromosome |
| Accession | NZ_CP077865 | ||
| Organism | Staphylococcus aureus strain 370 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | KU528_RS03950 | Protein ID | WP_001802298.1 |
| Coordinates | 770856..770960 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 770743..770798 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU528_RS03925 | 766934..767599 | - | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
| KU528_RS03930 | 767751..768071 | + | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| KU528_RS03935 | 768073..769050 | + | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
| KU528_RS03940 | 769316..770407 | + | 1092 | WP_000495695.1 | hypothetical protein | - |
| - | 770743..770798 | + | 56 | - | - | Antitoxin |
| KU528_RS03950 | 770856..770960 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| KU528_RS03955 | 771121..771604 | - | 484 | Protein_744 | recombinase family protein | - |
| KU528_RS03960 | 771647..772783 | - | 1137 | Protein_745 | SAP domain-containing protein | - |
| KU528_RS03965 | 773072..773164 | + | 93 | WP_031844941.1 | hypothetical protein | - |
| KU528_RS03970 | 773451..773665 | + | 215 | Protein_747 | exotoxin | - |
| KU528_RS03975 | 773859..774716 | - | 858 | WP_225805762.1 | HAD family hydrolase | - |
| KU528_RS03980 | 774784..775566 | - | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T208269 WP_001802298.1 NZ_CP077865:c770960-770856 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T208269 NZ_CP103609:c2205370-2205263 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT208269 NZ_CP077865:770743-770798 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|