Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 228556..228855 | Replicon | chromosome |
Accession | NZ_CP077861 | ||
Organism | Staphylococcus aureus strain 372 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | KU510_RS01055 | Protein ID | WP_011447039.1 |
Coordinates | 228679..228855 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 228556..228611 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU510_RS01015 | 224116..224295 | + | 180 | WP_000669791.1 | hypothetical protein | - |
KU510_RS01020 | 224606..224866 | + | 261 | WP_001791826.1 | hypothetical protein | - |
KU510_RS01025 | 224919..225269 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
KU510_RS01030 | 225779..226114 | - | 336 | Protein_204 | SH3 domain-containing protein | - |
KU510_RS01035 | 226764..227255 | - | 492 | WP_000919350.1 | staphylokinase | - |
KU510_RS01040 | 227446..228201 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
KU510_RS01045 | 228213..228467 | - | 255 | WP_000611512.1 | phage holin | - |
KU510_RS01050 | 228519..228626 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 228548..228687 | + | 140 | NuclAT_0 | - | - |
- | 228548..228687 | + | 140 | NuclAT_0 | - | - |
- | 228548..228687 | + | 140 | NuclAT_0 | - | - |
- | 228548..228687 | + | 140 | NuclAT_0 | - | - |
- | 228556..228611 | + | 56 | - | - | Antitoxin |
KU510_RS01055 | 228679..228855 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
KU510_RS01060 | 229005..229301 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
KU510_RS01065 | 229359..229646 | - | 288 | WP_094659775.1 | hypothetical protein | - |
KU510_RS01070 | 229693..229845 | - | 153 | WP_001153681.1 | hypothetical protein | - |
KU510_RS01075 | 229835..233620 | - | 3786 | WP_000582158.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak | 218182..268134 | 49952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T208236 WP_011447039.1 NZ_CP077861:c228855-228679 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T208236 NZ_CP103596:2685143-2685250 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT208236 NZ_CP077861:228556-228611 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|