Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1402266..1402450 | Replicon | chromosome |
Accession | NZ_CP077860 | ||
Organism | Staphylococcus aureus strain AC4 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | KU521_RS07130 | Protein ID | WP_000482652.1 |
Coordinates | 1402343..1402450 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1402266..1402326 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU521_RS07115 | 1397722..1397853 | - | 132 | WP_223197975.1 | hypothetical protein | - |
KU521_RS07120 | 1398120..1399853 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
KU521_RS07125 | 1399878..1401641 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
- | 1402266..1402326 | + | 61 | - | - | Antitoxin |
KU521_RS07130 | 1402343..1402450 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
KU521_RS07135 | 1402584..1402970 | - | 387 | WP_000779360.1 | flippase GtxA | - |
KU521_RS07140 | 1403238..1404380 | + | 1143 | WP_225798608.1 | glycerate kinase | - |
KU521_RS07145 | 1404440..1405099 | + | 660 | WP_000831298.1 | membrane protein | - |
KU521_RS07150 | 1405281..1406492 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
KU521_RS07155 | 1406615..1407088 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T208231 WP_000482652.1 NZ_CP077860:c1402450-1402343 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208231 NZ_CP103596:1969627-1969730 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT208231 NZ_CP077860:1402266-1402326 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|