Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2219961..2220145 | Replicon | chromosome |
Accession | NZ_CP077858 | ||
Organism | Staphylococcus aureus strain AC6 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | KU543_RS10800 | Protein ID | WP_000482652.1 |
Coordinates | 2219961..2220068 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2220085..2220145 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU543_RS10775 | 2215323..2215796 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
KU543_RS10780 | 2215919..2217130 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
KU543_RS10785 | 2217312..2217971 | - | 660 | WP_000831298.1 | membrane protein | - |
KU543_RS10790 | 2218031..2219173 | - | 1143 | WP_225798608.1 | glycerate kinase | - |
KU543_RS10795 | 2219441..2219827 | + | 387 | WP_000779360.1 | flippase GtxA | - |
KU543_RS10800 | 2219961..2220068 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2220085..2220145 | - | 61 | - | - | Antitoxin |
KU543_RS10805 | 2220770..2222533 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
KU543_RS10810 | 2222558..2224291 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
KU543_RS10815 | 2224558..2224689 | + | 132 | WP_223197975.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T208189 WP_000482652.1 NZ_CP077858:2219961-2220068 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208189 NZ_CP103589:4259493-4259645 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 61 bp
>AT208189 NZ_CP077858:c2220145-2220085 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|