Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2220473..2220657 | Replicon | chromosome |
Accession | NZ_CP077853 | ||
Organism | Staphylococcus aureus strain N5 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | KU499_RS10805 | Protein ID | WP_000482652.1 |
Coordinates | 2220473..2220580 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2220597..2220657 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU499_RS10780 | 2215835..2216308 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
KU499_RS10785 | 2216431..2217642 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
KU499_RS10790 | 2217824..2218483 | - | 660 | WP_000831298.1 | membrane protein | - |
KU499_RS10795 | 2218543..2219685 | - | 1143 | WP_225798608.1 | glycerate kinase | - |
KU499_RS10800 | 2219953..2220339 | + | 387 | WP_000779360.1 | flippase GtxA | - |
KU499_RS10805 | 2220473..2220580 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2220597..2220657 | - | 61 | - | - | Antitoxin |
KU499_RS10810 | 2221282..2223045 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
KU499_RS10815 | 2223070..2224803 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
KU499_RS10820 | 2225070..2225201 | + | 132 | WP_223197975.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T208101 WP_000482652.1 NZ_CP077853:2220473-2220580 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T208101 NZ_CP103570:184326-184433 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT208101 NZ_CP077853:c2220657-2220597 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|