Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 785369..785627 | Replicon | chromosome |
Accession | NZ_CP077850 | ||
Organism | Erwinia amylovora strain CP200242 isolate missinsg |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | KTR61_RS03420 | Protein ID | WP_231840709.1 |
Coordinates | 785529..785627 (+) | Length | 33 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 785369..785415 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KTR61_RS03380 (KTR61_03350) | 780815..780958 | - | 144 | WP_004160049.1 | hypothetical protein | - |
KTR61_RS03385 (KTR61_03355) | 781431..781823 | - | 393 | WP_004160048.1 | DoxX family protein | - |
KTR61_RS03390 (KTR61_03360) | 782033..782314 | - | 282 | WP_004160039.1 | YqjK-like family protein | - |
KTR61_RS03395 (KTR61_03365) | 782314..782706 | - | 393 | WP_004160038.1 | phage holin family protein | - |
KTR61_RS03400 (KTR61_03370) | 782708..783013 | - | 306 | WP_004160037.1 | DUF883 family protein | - |
KTR61_RS03405 (KTR61_03375) | 783056..783427 | - | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
KTR61_RS03410 (KTR61_03380) | 783595..783987 | - | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
KTR61_RS03415 (KTR61_03385) | 783984..784658 | - | 675 | WP_004160034.1 | DedA family protein | - |
- | 785369..785415 | - | 47 | - | - | Antitoxin |
KTR61_RS03420 | 785529..785627 | + | 99 | WP_231840709.1 | Hok/Gef family protein | Toxin |
KTR61_RS03425 (KTR61_03395) | 785771..787003 | - | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
KTR61_RS03430 (KTR61_03400) | 787238..788218 | - | 981 | WP_013035818.1 | TerC family protein | - |
KTR61_RS03435 (KTR61_03405) | 788631..790322 | + | 1692 | WP_004160025.1 | chloride channel protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3810.40 Da Isoelectric Point: 8.9407
>T208070 WP_231840709.1 NZ_CP077850:785529-785627 [Erwinia amylovora]
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 99 bp
>T208070 NZ_CP103562:2249247-2249349 [Escherichia coli O25b:H4-ST131]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 47 bp
>AT208070 NZ_CP077850:c785415-785369 [Erwinia amylovora]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|