Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 90006..90186 | Replicon | chromosome |
Accession | NZ_CP077755 | ||
Organism | Staphylococcus aureus strain WHC09 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | KTR65_RS00595 | Protein ID | WP_001801861.1 |
Coordinates | 90091..90186 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 90006..90063 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KTR65_RS00575 | 85294..86064 | + | 771 | WP_000764689.1 | staphylococcal enterotoxin type U | - |
KTR65_RS00580 | 86103..86261 | + | 159 | Protein_77 | exotoxin | - |
KTR65_RS00585 | 86313..87485 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
KTR65_RS14155 | 87745..88254 | + | 510 | WP_224684909.1 | hypothetical protein | - |
KTR65_RS00590 | 88316..89440 | + | 1125 | WP_223876714.1 | hypothetical protein | - |
KTR65_RS14160 | 89870..89968 | - | 99 | Protein_81 | hypothetical protein | - |
- | 90006..90063 | + | 58 | - | - | Antitoxin |
KTR65_RS00595 | 90091..90186 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
KTR65_RS00600 | 90638..91084 | + | 447 | WP_217838626.1 | DUF1433 domain-containing protein | - |
KTR65_RS00605 | 91198..91824 | + | 627 | Protein_84 | ImmA/IrrE family metallo-endopeptidase | - |
KTR65_RS00610 | 91956..92708 | - | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
KTR65_RS00615 | 92735..93418 | - | 684 | WP_000957233.1 | exotoxin beta-grasp domain-containing protein | - |
KTR65_RS00620 | 93505..94131 | - | 627 | WP_000669028.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 86313..87485 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T207695 WP_001801861.1 NZ_CP077755:c90186-90091 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T207695 NZ_CP103479:2954185-2954292 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT207695 NZ_CP077755:90006-90063 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|