Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2504766..2504950 | Replicon | chromosome |
| Accession | NC_003923 | ||
| Organism | Staphylococcus aureus subsp. aureus MW2 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | MW_RS12760 | Protein ID | WP_000482647.1 |
| Coordinates | 2504843..2504950 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2504766..2504826 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW_RS12735 | 2500240..2500407 | - | 168 | WP_001793334.1 | hypothetical protein | - |
| MW_RS12745 (MW2351) | 2500638..2502371 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| MW_RS12750 (MW2352) | 2502396..2504159 | - | 1764 | WP_001064815.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2504766..2504826 | + | 61 | - | - | Antitoxin |
| MW_RS12760 | 2504843..2504950 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| MW_RS12765 (MW2355) | 2505084..2505470 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| MW_RS12770 (MW2356) | 2505728..2506870 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
| MW_RS12775 (MW2357) | 2506930..2507589 | + | 660 | WP_000831301.1 | membrane protein | - |
| MW_RS12780 (MW2358) | 2507771..2508982 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| MW_RS12785 (MW2359) | 2509105..2509578 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T20744 WP_000482647.1 NC_003923:c2504950-2504843 [Staphylococcus aureus subsp. aureus MW2]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T20744 NC_003923:c2504950-2504843 [Staphylococcus aureus subsp. aureus MW2]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT20744 NC_003923:2504766-2504826 [Staphylococcus aureus subsp. aureus MW2]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|