Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1894021..1894203 | Replicon | chromosome |
| Accession | NC_003923 | ||
| Organism | Staphylococcus aureus subsp. aureus MW2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | MW_RS15155 | Protein ID | WP_001801861.1 |
| Coordinates | 1894021..1894116 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1894144..1894203 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW_RS09280 (MW1739) | 1889691..1890317 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| MW_RS09285 (MW1740) | 1890358..1890699 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| MW_RS09290 (MW1741) | 1890800..1891372 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| MW_RS09295 (MW1742) | 1891570..1892127 | - | 558 | Protein_1784 | ImmA/IrrE family metallo-endopeptidase | - |
| MW_RS09305 (MW1743) | 1892501..1892677 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| MW_RS09310 (MW1744) | 1892688..1893071 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| MW_RS09320 (MW1747) | 1893675..1893818 | - | 144 | WP_001549059.1 | transposase | - |
| MW_RS15155 | 1894021..1894116 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1894144..1894203 | - | 60 | - | - | Antitoxin |
| MW_RS09325 | 1894239..1894340 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| MW_RS14780 | 1894318..1894494 | - | 177 | Protein_1790 | transposase | - |
| MW_RS09330 (MW1748) | 1894688..1895065 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T20732 WP_001801861.1 NC_003923:1894021-1894116 [Staphylococcus aureus subsp. aureus MW2]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T20732 NC_003923:1894021-1894116 [Staphylococcus aureus subsp. aureus MW2]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT20732 NC_003923:c1894203-1894144 [Staphylococcus aureus subsp. aureus MW2]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|