Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1427698..1427919 Replicon chromosome
Accession NZ_CP076709
Organism Escherichia coli O158:H23 strain CFIAFB20140388

Toxin (Protein)


Gene name ldrD Uniprot ID L4JC91
Locus tag KQ220_RS06735 Protein ID WP_000170956.1
Coordinates 1427698..1427805 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1427853..1427919 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KQ220_RS06710 (1423542) 1423542..1424624 + 1083 WP_000804726.1 peptide chain release factor 1 -
KQ220_RS06715 (1424624) 1424624..1425457 + 834 WP_064226305.1 peptide chain release factor N(5)-glutamine methyltransferase -
KQ220_RS06720 (1425454) 1425454..1425846 + 393 WP_085459520.1 invasion regulator SirB2 -
KQ220_RS06725 (1425850) 1425850..1426659 + 810 WP_001257044.1 invasion regulator SirB1 -
KQ220_RS06730 (1426695) 1426695..1427549 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KQ220_RS06735 (1427698) 1427698..1427805 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1427855) 1427855..1427918 + 64 NuclAT_25 - -
- (1427855) 1427855..1427918 + 64 NuclAT_25 - -
- (1427855) 1427855..1427918 + 64 NuclAT_25 - -
- (1427855) 1427855..1427918 + 64 NuclAT_25 - -
- (1427855) 1427855..1427918 + 64 NuclAT_27 - -
- (1427855) 1427855..1427918 + 64 NuclAT_27 - -
- (1427855) 1427855..1427918 + 64 NuclAT_27 - -
- (1427855) 1427855..1427918 + 64 NuclAT_27 - -
- (1427855) 1427855..1427918 + 64 NuclAT_29 - -
- (1427855) 1427855..1427918 + 64 NuclAT_29 - -
- (1427855) 1427855..1427918 + 64 NuclAT_29 - -
- (1427855) 1427855..1427918 + 64 NuclAT_29 - -
- (1427855) 1427855..1427918 + 64 NuclAT_31 - -
- (1427855) 1427855..1427918 + 64 NuclAT_31 - -
- (1427855) 1427855..1427918 + 64 NuclAT_31 - -
- (1427855) 1427855..1427918 + 64 NuclAT_31 - -
- (1427855) 1427855..1427918 + 64 NuclAT_33 - -
- (1427855) 1427855..1427918 + 64 NuclAT_33 - -
- (1427855) 1427855..1427918 + 64 NuclAT_33 - -
- (1427855) 1427855..1427918 + 64 NuclAT_33 - -
- (1427855) 1427855..1427918 + 64 NuclAT_35 - -
- (1427855) 1427855..1427918 + 64 NuclAT_35 - -
- (1427855) 1427855..1427918 + 64 NuclAT_35 - -
- (1427855) 1427855..1427918 + 64 NuclAT_35 - -
- (1427853) 1427853..1427919 + 67 NuclAT_13 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_13 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_13 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_13 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_15 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_15 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_15 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_15 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_17 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_17 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_17 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_17 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_19 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_19 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_19 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_19 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_21 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_21 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_21 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_21 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_23 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_23 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_23 - Antitoxin
- (1427853) 1427853..1427919 + 67 NuclAT_23 - Antitoxin
- (1427855) 1427855..1427920 + 66 NuclAT_37 - -
- (1427855) 1427855..1427920 + 66 NuclAT_37 - -
- (1427855) 1427855..1427920 + 66 NuclAT_37 - -
- (1427855) 1427855..1427920 + 66 NuclAT_37 - -
- (1427855) 1427855..1427920 + 66 NuclAT_39 - -
- (1427855) 1427855..1427920 + 66 NuclAT_39 - -
- (1427855) 1427855..1427920 + 66 NuclAT_39 - -
- (1427855) 1427855..1427920 + 66 NuclAT_39 - -
- (1427855) 1427855..1427920 + 66 NuclAT_41 - -
- (1427855) 1427855..1427920 + 66 NuclAT_41 - -
- (1427855) 1427855..1427920 + 66 NuclAT_41 - -
- (1427855) 1427855..1427920 + 66 NuclAT_41 - -
KQ220_RS06740 (1428233) 1428233..1428340 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1428393) 1428393..1428454 + 62 NuclAT_26 - -
- (1428393) 1428393..1428454 + 62 NuclAT_26 - -
- (1428393) 1428393..1428454 + 62 NuclAT_26 - -
- (1428393) 1428393..1428454 + 62 NuclAT_26 - -
- (1428393) 1428393..1428454 + 62 NuclAT_28 - -
- (1428393) 1428393..1428454 + 62 NuclAT_28 - -
- (1428393) 1428393..1428454 + 62 NuclAT_28 - -
- (1428393) 1428393..1428454 + 62 NuclAT_28 - -
- (1428393) 1428393..1428454 + 62 NuclAT_30 - -
- (1428393) 1428393..1428454 + 62 NuclAT_30 - -
- (1428393) 1428393..1428454 + 62 NuclAT_30 - -
- (1428393) 1428393..1428454 + 62 NuclAT_30 - -
- (1428393) 1428393..1428454 + 62 NuclAT_32 - -
- (1428393) 1428393..1428454 + 62 NuclAT_32 - -
- (1428393) 1428393..1428454 + 62 NuclAT_32 - -
- (1428393) 1428393..1428454 + 62 NuclAT_32 - -
- (1428393) 1428393..1428454 + 62 NuclAT_34 - -
- (1428393) 1428393..1428454 + 62 NuclAT_34 - -
- (1428393) 1428393..1428454 + 62 NuclAT_34 - -
- (1428393) 1428393..1428454 + 62 NuclAT_34 - -
- (1428393) 1428393..1428454 + 62 NuclAT_36 - -
- (1428393) 1428393..1428454 + 62 NuclAT_36 - -
- (1428393) 1428393..1428454 + 62 NuclAT_36 - -
- (1428393) 1428393..1428454 + 62 NuclAT_36 - -
- (1428393) 1428393..1428455 + 63 NuclAT_14 - -
- (1428393) 1428393..1428455 + 63 NuclAT_14 - -
- (1428393) 1428393..1428455 + 63 NuclAT_14 - -
- (1428393) 1428393..1428455 + 63 NuclAT_14 - -
- (1428393) 1428393..1428455 + 63 NuclAT_16 - -
- (1428393) 1428393..1428455 + 63 NuclAT_16 - -
- (1428393) 1428393..1428455 + 63 NuclAT_16 - -
- (1428393) 1428393..1428455 + 63 NuclAT_16 - -
- (1428393) 1428393..1428455 + 63 NuclAT_18 - -
- (1428393) 1428393..1428455 + 63 NuclAT_18 - -
- (1428393) 1428393..1428455 + 63 NuclAT_18 - -
- (1428393) 1428393..1428455 + 63 NuclAT_18 - -
- (1428393) 1428393..1428455 + 63 NuclAT_20 - -
- (1428393) 1428393..1428455 + 63 NuclAT_20 - -
- (1428393) 1428393..1428455 + 63 NuclAT_20 - -
- (1428393) 1428393..1428455 + 63 NuclAT_20 - -
- (1428393) 1428393..1428455 + 63 NuclAT_22 - -
- (1428393) 1428393..1428455 + 63 NuclAT_22 - -
- (1428393) 1428393..1428455 + 63 NuclAT_22 - -
- (1428393) 1428393..1428455 + 63 NuclAT_22 - -
- (1428393) 1428393..1428455 + 63 NuclAT_24 - -
- (1428393) 1428393..1428455 + 63 NuclAT_24 - -
- (1428393) 1428393..1428455 + 63 NuclAT_24 - -
- (1428393) 1428393..1428455 + 63 NuclAT_24 - -
- (1428393) 1428393..1428456 + 64 NuclAT_38 - -
- (1428393) 1428393..1428456 + 64 NuclAT_38 - -
- (1428393) 1428393..1428456 + 64 NuclAT_38 - -
- (1428393) 1428393..1428456 + 64 NuclAT_38 - -
- (1428393) 1428393..1428456 + 64 NuclAT_40 - -
- (1428393) 1428393..1428456 + 64 NuclAT_40 - -
- (1428393) 1428393..1428456 + 64 NuclAT_40 - -
- (1428393) 1428393..1428456 + 64 NuclAT_40 - -
- (1428393) 1428393..1428456 + 64 NuclAT_42 - -
- (1428393) 1428393..1428456 + 64 NuclAT_42 - -
- (1428393) 1428393..1428456 + 64 NuclAT_42 - -
- (1428393) 1428393..1428456 + 64 NuclAT_42 - -
KQ220_RS06745 (1428746) 1428746..1429846 - 1101 WP_001366250.1 sodium-potassium/proton antiporter ChaA -
KQ220_RS06750 (1430116) 1430116..1430346 + 231 WP_001146444.1 putative cation transport regulator ChaB -
KQ220_RS06755 (1430504) 1430504..1431199 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KQ220_RS06760 (1431243) 1431243..1431596 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4041.88 Da        Isoelectric Point: 11.4779

>T206414 WP_000170956.1 NZ_CP076709:c1427805-1427698 [Escherichia coli O158:H23]
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T206414 NZ_CP102380:2648558-2648887 [Escherichia coli]
ATGAACACTCTACCTGCTACAATTTCGCAGGCGGCGAAGCCCTGCCTGTCGCCAGTGGCTGTCTGGCAAATGCTACTGAC
ACGCCTGCTGGAACAACACTATGGCCTGACACTGAACGACACGCCGTTCAGTGATGAAACTGTTATTAAGGAACATATCG
ATGCTGGTATCACTCTGGCCGATGCAGTCAATTTTCTGGTGGAAAAGTACGAACTGGTACGTATCGATCACAGAGGATTT
TCGTGGCAACAACAGTCTCCATATATTTCCGTAGTAGATATTCTGCGAGCAAGGCGCTCTACCGGCTTGCTAAAAACTAA
TGTGAAATAA

Antitoxin


Download         Length: 67 bp

>AT206414 NZ_CP076709:1427853-1427919 [Escherichia coli O158:H23]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G035

Antitoxin

Download structure file

References