Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1427698..1427919 | Replicon | chromosome |
| Accession | NZ_CP076709 | ||
| Organism | Escherichia coli O158:H23 strain CFIAFB20140388 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | L4JC91 |
| Locus tag | KQ220_RS06735 | Protein ID | WP_000170956.1 |
| Coordinates | 1427698..1427805 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1427853..1427919 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KQ220_RS06710 (1423542) | 1423542..1424624 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| KQ220_RS06715 (1424624) | 1424624..1425457 | + | 834 | WP_064226305.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| KQ220_RS06720 (1425454) | 1425454..1425846 | + | 393 | WP_085459520.1 | invasion regulator SirB2 | - |
| KQ220_RS06725 (1425850) | 1425850..1426659 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| KQ220_RS06730 (1426695) | 1426695..1427549 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| KQ220_RS06735 (1427698) | 1427698..1427805 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_25 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_25 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_25 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_25 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_27 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_27 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_27 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_27 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_29 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_29 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_29 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_29 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_31 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_31 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_31 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_31 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_33 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_33 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_33 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_33 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_35 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_35 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_35 | - | - |
| - (1427855) | 1427855..1427918 | + | 64 | NuclAT_35 | - | - |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (1427853) | 1427853..1427919 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_37 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_37 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_37 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_37 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_39 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_39 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_39 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_39 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_41 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_41 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_41 | - | - |
| - (1427855) | 1427855..1427920 | + | 66 | NuclAT_41 | - | - |
| KQ220_RS06740 (1428233) | 1428233..1428340 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_26 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_26 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_26 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_26 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_28 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_28 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_28 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_28 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_30 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_30 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_30 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_30 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_32 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_32 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_32 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_32 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_34 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_34 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_34 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_34 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_36 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_36 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_36 | - | - |
| - (1428393) | 1428393..1428454 | + | 62 | NuclAT_36 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_14 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_14 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_14 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_14 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_16 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_16 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_16 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_16 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_18 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_18 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_18 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_18 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_20 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_20 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_20 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_20 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_22 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_22 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_22 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_22 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_24 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_24 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_24 | - | - |
| - (1428393) | 1428393..1428455 | + | 63 | NuclAT_24 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_38 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_38 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_38 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_38 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_40 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_40 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_40 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_40 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_42 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_42 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_42 | - | - |
| - (1428393) | 1428393..1428456 | + | 64 | NuclAT_42 | - | - |
| KQ220_RS06745 (1428746) | 1428746..1429846 | - | 1101 | WP_001366250.1 | sodium-potassium/proton antiporter ChaA | - |
| KQ220_RS06750 (1430116) | 1430116..1430346 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| KQ220_RS06755 (1430504) | 1430504..1431199 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| KQ220_RS06760 (1431243) | 1431243..1431596 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4041.88 Da Isoelectric Point: 11.4779
>T206414 WP_000170956.1 NZ_CP076709:c1427805-1427698 [Escherichia coli O158:H23]
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T206414 NZ_CP102380:2648558-2648887 [Escherichia coli]
ATGAACACTCTACCTGCTACAATTTCGCAGGCGGCGAAGCCCTGCCTGTCGCCAGTGGCTGTCTGGCAAATGCTACTGAC
ACGCCTGCTGGAACAACACTATGGCCTGACACTGAACGACACGCCGTTCAGTGATGAAACTGTTATTAAGGAACATATCG
ATGCTGGTATCACTCTGGCCGATGCAGTCAATTTTCTGGTGGAAAAGTACGAACTGGTACGTATCGATCACAGAGGATTT
TCGTGGCAACAACAGTCTCCATATATTTCCGTAGTAGATATTCTGCGAGCAAGGCGCTCTACCGGCTTGCTAAAAACTAA
TGTGAAATAA
ATGAACACTCTACCTGCTACAATTTCGCAGGCGGCGAAGCCCTGCCTGTCGCCAGTGGCTGTCTGGCAAATGCTACTGAC
ACGCCTGCTGGAACAACACTATGGCCTGACACTGAACGACACGCCGTTCAGTGATGAAACTGTTATTAAGGAACATATCG
ATGCTGGTATCACTCTGGCCGATGCAGTCAATTTTCTGGTGGAAAAGTACGAACTGGTACGTATCGATCACAGAGGATTT
TCGTGGCAACAACAGTCTCCATATATTTCCGTAGTAGATATTCTGCGAGCAAGGCGCTCTACCGGCTTGCTAAAAACTAA
TGTGAAATAA
Antitoxin
Download Length: 67 bp
>AT206414 NZ_CP076709:1427853-1427919 [Escherichia coli O158:H23]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|