Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 56348..56601 Replicon plasmid unnamed
Accession NZ_CP076705
Organism Escherichia coli O8:H28 strain BMH-17-0027

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag KQ221_RS23385 Protein ID WP_001312851.1
Coordinates 56348..56497 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 56542..56601 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KQ221_RS23355 (52314) 52314..52553 - 240 WP_097446501.1 helix-turn-helix domain-containing protein -
KQ221_RS23360 (53527) 53527..54384 - 858 WP_000130957.1 incFII family plasmid replication initiator RepA -
KQ221_RS23935 (54377) 54377..54424 - 48 WP_235246954.1 hypothetical protein -
KQ221_RS23940 (54415) 54415..54648 + 234 WP_226058127.1 replication protein RepA -
KQ221_RS23370 (54684) 54684..54941 - 258 WP_097446499.1 replication regulatory protein RepA -
KQ221_RS23375 (55251) 55251..55733 - 483 WP_000405244.1 GNAT family N-acetyltransferase -
KQ221_RS23380 (55724) 55724..56026 - 303 WP_001346256.1 DUF1778 domain-containing protein -
KQ221_RS23385 (56348) 56348..56497 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (56542) 56542..56601 + 60 NuclAT_1 - Antitoxin
- (56542) 56542..56601 + 60 NuclAT_1 - Antitoxin
- (56542) 56542..56601 + 60 NuclAT_1 - Antitoxin
- (56542) 56542..56601 + 60 NuclAT_1 - Antitoxin
KQ221_RS23945 (56863) 56863..56931 - 69 Protein_50 endonuclease -
KQ221_RS23395 (57177) 57177..57389 - 213 WP_032289176.1 hypothetical protein -
KQ221_RS23400 (57519) 57519..58079 - 561 WP_097446497.1 fertility inhibition protein FinO -
KQ221_RS23405 (58134) 58134..58880 - 747 WP_097446496.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC 1..117710 117710


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T206371 WP_001312851.1 NZ_CP076705:c56497-56348 [Escherichia coli O8:H28]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T206371 NZ_CP102378:c3710723-3710616 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT206371 NZ_CP076705:56542-56601 [Escherichia coli O8:H28]
TAAGTACATCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References