Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1385335..1385556 Replicon chromosome
Accession NZ_CP076693
Organism Escherichia coli strain S103EC

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag KQ261_RS06905 Protein ID WP_001531632.1
Coordinates 1385335..1385442 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1385490..1385556 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KQ261_RS06880 (1381179) 1381179..1382261 + 1083 WP_000804726.1 peptide chain release factor 1 -
KQ261_RS06885 (1382261) 1382261..1383094 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
KQ261_RS06890 (1383091) 1383091..1383483 + 393 WP_000200375.1 invasion regulator SirB2 -
KQ261_RS06895 (1383487) 1383487..1384296 + 810 WP_001257044.1 invasion regulator SirB1 -
KQ261_RS06900 (1384332) 1384332..1385186 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KQ261_RS06905 (1385335) 1385335..1385442 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1385492) 1385492..1385555 + 64 NuclAT_12 - -
- (1385492) 1385492..1385555 + 64 NuclAT_12 - -
- (1385492) 1385492..1385555 + 64 NuclAT_12 - -
- (1385492) 1385492..1385555 + 64 NuclAT_12 - -
- (1385492) 1385492..1385555 + 64 NuclAT_13 - -
- (1385492) 1385492..1385555 + 64 NuclAT_13 - -
- (1385492) 1385492..1385555 + 64 NuclAT_13 - -
- (1385492) 1385492..1385555 + 64 NuclAT_13 - -
- (1385492) 1385492..1385555 + 64 NuclAT_14 - -
- (1385492) 1385492..1385555 + 64 NuclAT_14 - -
- (1385492) 1385492..1385555 + 64 NuclAT_14 - -
- (1385492) 1385492..1385555 + 64 NuclAT_14 - -
- (1385492) 1385492..1385555 + 64 NuclAT_15 - -
- (1385492) 1385492..1385555 + 64 NuclAT_15 - -
- (1385492) 1385492..1385555 + 64 NuclAT_15 - -
- (1385492) 1385492..1385555 + 64 NuclAT_15 - -
- (1385492) 1385492..1385555 + 64 NuclAT_16 - -
- (1385492) 1385492..1385555 + 64 NuclAT_16 - -
- (1385492) 1385492..1385555 + 64 NuclAT_16 - -
- (1385492) 1385492..1385555 + 64 NuclAT_16 - -
- (1385492) 1385492..1385555 + 64 NuclAT_17 - -
- (1385492) 1385492..1385555 + 64 NuclAT_17 - -
- (1385492) 1385492..1385555 + 64 NuclAT_17 - -
- (1385492) 1385492..1385555 + 64 NuclAT_17 - -
- (1385490) 1385490..1385556 + 67 NuclAT_10 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_10 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_10 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_10 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_5 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_5 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_5 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_5 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_6 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_6 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_6 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_6 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_7 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_7 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_7 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_7 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_8 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_8 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_8 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_8 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_9 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_9 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_9 - Antitoxin
- (1385490) 1385490..1385556 + 67 NuclAT_9 - Antitoxin
- (1385492) 1385492..1385557 + 66 NuclAT_18 - -
- (1385492) 1385492..1385557 + 66 NuclAT_18 - -
- (1385492) 1385492..1385557 + 66 NuclAT_18 - -
- (1385492) 1385492..1385557 + 66 NuclAT_18 - -
- (1385492) 1385492..1385557 + 66 NuclAT_19 - -
- (1385492) 1385492..1385557 + 66 NuclAT_19 - -
- (1385492) 1385492..1385557 + 66 NuclAT_19 - -
- (1385492) 1385492..1385557 + 66 NuclAT_19 - -
- (1385492) 1385492..1385557 + 66 NuclAT_20 - -
- (1385492) 1385492..1385557 + 66 NuclAT_20 - -
- (1385492) 1385492..1385557 + 66 NuclAT_20 - -
- (1385492) 1385492..1385557 + 66 NuclAT_20 - -
- (1385492) 1385492..1385557 + 66 NuclAT_21 - -
- (1385492) 1385492..1385557 + 66 NuclAT_21 - -
- (1385492) 1385492..1385557 + 66 NuclAT_21 - -
- (1385492) 1385492..1385557 + 66 NuclAT_21 - -
- (1385492) 1385492..1385557 + 66 NuclAT_22 - -
- (1385492) 1385492..1385557 + 66 NuclAT_22 - -
- (1385492) 1385492..1385557 + 66 NuclAT_22 - -
- (1385492) 1385492..1385557 + 66 NuclAT_22 - -
- (1385492) 1385492..1385557 + 66 NuclAT_23 - -
- (1385492) 1385492..1385557 + 66 NuclAT_23 - -
- (1385492) 1385492..1385557 + 66 NuclAT_23 - -
- (1385492) 1385492..1385557 + 66 NuclAT_23 - -
KQ261_RS06910 (1385847) 1385847..1386947 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
KQ261_RS06915 (1387217) 1387217..1387456 + 240 WP_000120702.1 putative cation transport regulator ChaB -
KQ261_RS06920 (1387605) 1387605..1388300 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KQ261_RS06925 (1388344) 1388344..1388697 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
KQ261_RS06930 (1388882) 1388882..1390276 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T206269 WP_001531632.1 NZ_CP076693:c1385442-1385335 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T206269 NZ_CP102292:138928-139329 [[Ruminococcus] lactaris ATCC 29176]
ATGAGATATATGTTGGATACGAATATCTGTATCTATGCGATTAAGAAAAAGCCGGAGGAAGTGTTCAGGCGATTACAACA
ACATGATCCATCAGAAGTATGTATTTCAGCAGTCACCTATGCAGAATTAATGCATGGCGTGGAAAAAAGTAAAGCGGTGG
AAAAGAATCGCCTTGCCCTCACGTTATTACTGGCCAACATTGAGATTCTGGATTTTGACAGTTTGGCTGCGGAAAGTTAT
GGAAAGATCCGGGCTGATTTAGAAAAAGCAGGAACACCAATCGGTCCATTGGACATGATGATTGCCGGTCATGCACAGTC
ATTAGGATATACGGTTGTTACAAATAATACAAAAGAATTTGATCGGGTAAAATCATTGAAAGTTGAAAATTGGGCAAATT
AG

Antitoxin


Download         Length: 67 bp

>AT206269 NZ_CP076693:1385490-1385556 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References