Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1479275..1479496 Replicon chromosome
Accession NZ_CP076689
Organism Escherichia coli strain S21EC

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag KQ260_RS07565 Protein ID WP_001531632.1
Coordinates 1479275..1479382 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1479430..1479496 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KQ260_RS07540 (1475119) 1475119..1476201 + 1083 WP_000804726.1 peptide chain release factor 1 -
KQ260_RS07545 (1476201) 1476201..1477034 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
KQ260_RS07550 (1477031) 1477031..1477423 + 393 WP_000200375.1 invasion regulator SirB2 -
KQ260_RS07555 (1477427) 1477427..1478236 + 810 WP_001257044.1 invasion regulator SirB1 -
KQ260_RS07560 (1478272) 1478272..1479126 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KQ260_RS07565 (1479275) 1479275..1479382 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1479432) 1479432..1479495 + 64 NuclAT_12 - -
- (1479432) 1479432..1479495 + 64 NuclAT_12 - -
- (1479432) 1479432..1479495 + 64 NuclAT_12 - -
- (1479432) 1479432..1479495 + 64 NuclAT_12 - -
- (1479432) 1479432..1479495 + 64 NuclAT_13 - -
- (1479432) 1479432..1479495 + 64 NuclAT_13 - -
- (1479432) 1479432..1479495 + 64 NuclAT_13 - -
- (1479432) 1479432..1479495 + 64 NuclAT_13 - -
- (1479432) 1479432..1479495 + 64 NuclAT_14 - -
- (1479432) 1479432..1479495 + 64 NuclAT_14 - -
- (1479432) 1479432..1479495 + 64 NuclAT_14 - -
- (1479432) 1479432..1479495 + 64 NuclAT_14 - -
- (1479432) 1479432..1479495 + 64 NuclAT_15 - -
- (1479432) 1479432..1479495 + 64 NuclAT_15 - -
- (1479432) 1479432..1479495 + 64 NuclAT_15 - -
- (1479432) 1479432..1479495 + 64 NuclAT_15 - -
- (1479432) 1479432..1479495 + 64 NuclAT_16 - -
- (1479432) 1479432..1479495 + 64 NuclAT_16 - -
- (1479432) 1479432..1479495 + 64 NuclAT_16 - -
- (1479432) 1479432..1479495 + 64 NuclAT_16 - -
- (1479432) 1479432..1479495 + 64 NuclAT_17 - -
- (1479432) 1479432..1479495 + 64 NuclAT_17 - -
- (1479432) 1479432..1479495 + 64 NuclAT_17 - -
- (1479432) 1479432..1479495 + 64 NuclAT_17 - -
- (1479430) 1479430..1479496 + 67 NuclAT_10 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_10 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_10 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_10 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_5 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_5 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_5 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_5 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_6 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_6 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_6 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_6 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_7 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_7 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_7 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_7 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_8 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_8 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_8 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_8 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_9 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_9 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_9 - Antitoxin
- (1479430) 1479430..1479496 + 67 NuclAT_9 - Antitoxin
- (1479432) 1479432..1479497 + 66 NuclAT_18 - -
- (1479432) 1479432..1479497 + 66 NuclAT_18 - -
- (1479432) 1479432..1479497 + 66 NuclAT_18 - -
- (1479432) 1479432..1479497 + 66 NuclAT_18 - -
- (1479432) 1479432..1479497 + 66 NuclAT_19 - -
- (1479432) 1479432..1479497 + 66 NuclAT_19 - -
- (1479432) 1479432..1479497 + 66 NuclAT_19 - -
- (1479432) 1479432..1479497 + 66 NuclAT_19 - -
- (1479432) 1479432..1479497 + 66 NuclAT_20 - -
- (1479432) 1479432..1479497 + 66 NuclAT_20 - -
- (1479432) 1479432..1479497 + 66 NuclAT_20 - -
- (1479432) 1479432..1479497 + 66 NuclAT_20 - -
- (1479432) 1479432..1479497 + 66 NuclAT_21 - -
- (1479432) 1479432..1479497 + 66 NuclAT_21 - -
- (1479432) 1479432..1479497 + 66 NuclAT_21 - -
- (1479432) 1479432..1479497 + 66 NuclAT_21 - -
- (1479432) 1479432..1479497 + 66 NuclAT_22 - -
- (1479432) 1479432..1479497 + 66 NuclAT_22 - -
- (1479432) 1479432..1479497 + 66 NuclAT_22 - -
- (1479432) 1479432..1479497 + 66 NuclAT_22 - -
- (1479432) 1479432..1479497 + 66 NuclAT_23 - -
- (1479432) 1479432..1479497 + 66 NuclAT_23 - -
- (1479432) 1479432..1479497 + 66 NuclAT_23 - -
- (1479432) 1479432..1479497 + 66 NuclAT_23 - -
KQ260_RS07570 (1479787) 1479787..1480887 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
KQ260_RS07575 (1481157) 1481157..1481396 + 240 WP_000120702.1 putative cation transport regulator ChaB -
KQ260_RS07580 (1481545) 1481545..1482240 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KQ260_RS07585 (1482284) 1482284..1482637 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
KQ260_RS07590 (1482822) 1482822..1484216 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T206238 WP_001531632.1 NZ_CP076689:c1479382-1479275 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T206238 NZ_CP102244:c4230878-4230564 [Escherichia coli O7:H15]
ATGCAATTTACGGTATACCGCAGTCGCGGCAGGAACGCCGCGTTTCCCTTTGTTATCGATGTTACCAGCGACATTATTGG
TGAGATTAATCGCCGTATTGTTATTCCATTAACACCTATTGAACGATTTATCCGTATTCGCCCTCCAGAACGGCTTAACA
CAATCCTTTTACTGGTAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAAGGGGCATTAGATTTTATGCTCGACGGGATTTAA

Antitoxin


Download         Length: 67 bp

>AT206238 NZ_CP076689:1479430-1479496 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References