Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1405532..1405753 Replicon chromosome
Accession NZ_CP076687
Organism Escherichia coli strain S22EC

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag KQ258_RS07020 Protein ID WP_001531632.1
Coordinates 1405532..1405639 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1405687..1405753 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KQ258_RS06995 (1401376) 1401376..1402458 + 1083 WP_000804726.1 peptide chain release factor 1 -
KQ258_RS07000 (1402458) 1402458..1403291 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
KQ258_RS07005 (1403288) 1403288..1403680 + 393 WP_000200375.1 invasion regulator SirB2 -
KQ258_RS07010 (1403684) 1403684..1404493 + 810 WP_001257044.1 invasion regulator SirB1 -
KQ258_RS07015 (1404529) 1404529..1405383 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KQ258_RS07020 (1405532) 1405532..1405639 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1405689) 1405689..1405752 + 64 NuclAT_12 - -
- (1405689) 1405689..1405752 + 64 NuclAT_12 - -
- (1405689) 1405689..1405752 + 64 NuclAT_12 - -
- (1405689) 1405689..1405752 + 64 NuclAT_12 - -
- (1405689) 1405689..1405752 + 64 NuclAT_13 - -
- (1405689) 1405689..1405752 + 64 NuclAT_13 - -
- (1405689) 1405689..1405752 + 64 NuclAT_13 - -
- (1405689) 1405689..1405752 + 64 NuclAT_13 - -
- (1405689) 1405689..1405752 + 64 NuclAT_14 - -
- (1405689) 1405689..1405752 + 64 NuclAT_14 - -
- (1405689) 1405689..1405752 + 64 NuclAT_14 - -
- (1405689) 1405689..1405752 + 64 NuclAT_14 - -
- (1405689) 1405689..1405752 + 64 NuclAT_15 - -
- (1405689) 1405689..1405752 + 64 NuclAT_15 - -
- (1405689) 1405689..1405752 + 64 NuclAT_15 - -
- (1405689) 1405689..1405752 + 64 NuclAT_15 - -
- (1405689) 1405689..1405752 + 64 NuclAT_16 - -
- (1405689) 1405689..1405752 + 64 NuclAT_16 - -
- (1405689) 1405689..1405752 + 64 NuclAT_16 - -
- (1405689) 1405689..1405752 + 64 NuclAT_16 - -
- (1405689) 1405689..1405752 + 64 NuclAT_17 - -
- (1405689) 1405689..1405752 + 64 NuclAT_17 - -
- (1405689) 1405689..1405752 + 64 NuclAT_17 - -
- (1405689) 1405689..1405752 + 64 NuclAT_17 - -
- (1405687) 1405687..1405753 + 67 NuclAT_10 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_10 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_10 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_10 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_5 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_5 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_5 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_5 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_6 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_6 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_6 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_6 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_7 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_7 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_7 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_7 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_8 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_8 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_8 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_8 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_9 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_9 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_9 - Antitoxin
- (1405687) 1405687..1405753 + 67 NuclAT_9 - Antitoxin
- (1405689) 1405689..1405754 + 66 NuclAT_18 - -
- (1405689) 1405689..1405754 + 66 NuclAT_18 - -
- (1405689) 1405689..1405754 + 66 NuclAT_18 - -
- (1405689) 1405689..1405754 + 66 NuclAT_18 - -
- (1405689) 1405689..1405754 + 66 NuclAT_19 - -
- (1405689) 1405689..1405754 + 66 NuclAT_19 - -
- (1405689) 1405689..1405754 + 66 NuclAT_19 - -
- (1405689) 1405689..1405754 + 66 NuclAT_19 - -
- (1405689) 1405689..1405754 + 66 NuclAT_20 - -
- (1405689) 1405689..1405754 + 66 NuclAT_20 - -
- (1405689) 1405689..1405754 + 66 NuclAT_20 - -
- (1405689) 1405689..1405754 + 66 NuclAT_20 - -
- (1405689) 1405689..1405754 + 66 NuclAT_21 - -
- (1405689) 1405689..1405754 + 66 NuclAT_21 - -
- (1405689) 1405689..1405754 + 66 NuclAT_21 - -
- (1405689) 1405689..1405754 + 66 NuclAT_21 - -
- (1405689) 1405689..1405754 + 66 NuclAT_22 - -
- (1405689) 1405689..1405754 + 66 NuclAT_22 - -
- (1405689) 1405689..1405754 + 66 NuclAT_22 - -
- (1405689) 1405689..1405754 + 66 NuclAT_22 - -
- (1405689) 1405689..1405754 + 66 NuclAT_23 - -
- (1405689) 1405689..1405754 + 66 NuclAT_23 - -
- (1405689) 1405689..1405754 + 66 NuclAT_23 - -
- (1405689) 1405689..1405754 + 66 NuclAT_23 - -
KQ258_RS07025 (1406044) 1406044..1407144 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
KQ258_RS07030 (1407414) 1407414..1407653 + 240 WP_000120702.1 putative cation transport regulator ChaB -
KQ258_RS07035 (1407802) 1407802..1408497 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KQ258_RS07040 (1408541) 1408541..1408894 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
KQ258_RS07045 (1409079) 1409079..1410473 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T206209 WP_001531632.1 NZ_CP076687:c1405639-1405532 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T206209 NZ_CP102192:4104787-4105005 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA

Antitoxin


Download         Length: 67 bp

>AT206209 NZ_CP076687:1405687-1405753 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References