Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2483934..2484118 | Replicon | chromosome |
| Accession | NC_002953 | ||
| Organism | Staphylococcus aureus subsp. aureus MSSA476 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | SAS_RS12625 | Protein ID | WP_000482647.1 |
| Coordinates | 2484011..2484118 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2483934..2483994 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAS_RS12600 | 2479408..2479575 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| SAS_RS12610 | 2479806..2481539 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| SAS_RS12615 | 2481564..2483327 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2483934..2483994 | + | 61 | - | - | Antitoxin |
| SAS_RS12625 | 2484011..2484118 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAS_RS12630 | 2484252..2484638 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| SAS_RS12635 | 2484896..2486038 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
| SAS_RS12640 | 2486098..2486757 | + | 660 | WP_000831301.1 | membrane protein | - |
| SAS_RS12645 | 2486939..2488150 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| SAS_RS12650 | 2488273..2488746 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T20618 WP_000482647.1 NC_002953:c2484118-2484011 [Staphylococcus aureus subsp. aureus MSSA476]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T20618 NC_002953:c2484118-2484011 [Staphylococcus aureus subsp. aureus MSSA476]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT20618 NC_002953:2483934-2483994 [Staphylococcus aureus subsp. aureus MSSA476]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|