Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF4/- |
| Location | 1708635..1708934 | Replicon | chromosome |
| Accession | NZ_CP076660 | ||
| Organism | Staphylococcus aureus strain SG511 Berlin | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | KQU62_RS08490 | Protein ID | WP_011447039.1 |
| Coordinates | 1708758..1708934 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 1708635..1708690 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KQU62_RS08450 | 1703966..1704226 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| KQU62_RS08455 | 1704279..1704629 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KQU62_RS08460 | 1705314..1705763 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KQU62_RS08465 | 1705858..1706193 | - | 336 | Protein_1636 | SH3 domain-containing protein | - |
| KQU62_RS08470 | 1706843..1707334 | - | 492 | WP_000919350.1 | staphylokinase | - |
| KQU62_RS08475 | 1707525..1708280 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KQU62_RS08480 | 1708292..1708546 | - | 255 | WP_000611512.1 | phage holin | - |
| KQU62_RS08485 | 1708598..1708705 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1708627..1708766 | + | 140 | NuclAT_0 | - | - |
| - | 1708627..1708766 | + | 140 | NuclAT_0 | - | - |
| - | 1708627..1708766 | + | 140 | NuclAT_0 | - | - |
| - | 1708627..1708766 | + | 140 | NuclAT_0 | - | - |
| - | 1708635..1708690 | + | 56 | - | - | Antitoxin |
| KQU62_RS08490 | 1708758..1708934 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| KQU62_RS08495 | 1709084..1709380 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KQU62_RS08500 | 1709438..1709725 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| KQU62_RS08505 | 1709772..1709924 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| KQU62_RS08510 | 1709914..1713699 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1704279..1757629 | 53350 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T206174 WP_011447039.1 NZ_CP076660:c1708934-1708758 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T206174 NZ_CP102179:4340520-4340735 [Pseudomonas canavaninivorans]
ATCGCCCGCCGCATTGATCGAGCTGCGGCGGGCAACTTGGGTGATGTAAAAGCGGTCGGGGATGGGGTTTTAGAGTTGCG
CGTGGACGTAGGCGCTGGGTACAGAGTCTATTTCACCATGCGCGGTGGAGTGGTCATCGTGCTACCGGCAGGTGGTGACA
AATCTTCACAAAATGCTGATATTCGGCGAGCGAAAAAATTGGCAAAGGAGATTTGA
ATCGCCCGCCGCATTGATCGAGCTGCGGCGGGCAACTTGGGTGATGTAAAAGCGGTCGGGGATGGGGTTTTAGAGTTGCG
CGTGGACGTAGGCGCTGGGTACAGAGTCTATTTCACCATGCGCGGTGGAGTGGTCATCGTGCTACCGGCAGGTGGTGACA
AATCTTCACAAAATGCTGATATTCGGCGAGCGAAAAAATTGGCAAAGGAGATTTGA
Antitoxin
Download Length: 56 bp
>AT206174 NZ_CP076660:1708635-1708690 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|