Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2205492..2205689 | Replicon | chromosome |
Accession | NC_002953 | ||
Organism | Staphylococcus aureus subsp. aureus MSSA476 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAS_RS11145 | Protein ID | WP_001802298.1 |
Coordinates | 2205585..2205689 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2205492..2205530 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAS_RS11125 | 2201676..2202341 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
SAS_RS11130 | 2202493..2202813 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAS_RS11135 | 2202815..2203795 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
SAS_RS11140 | 2204061..2205152 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2205492..2205530 | + | 39 | - | - | Antitoxin |
SAS_RS11145 | 2205585..2205689 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAS_RS14835 | 2206369..2206527 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAS_RS11150 | 2207186..2208043 | - | 858 | WP_000370917.1 | Cof-type HAD-IIB family hydrolase | - |
SAS_RS11155 | 2208111..2208893 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T20616 WP_001802298.1 NC_002953:c2205689-2205585 [Staphylococcus aureus subsp. aureus MSSA476]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T20616 NC_002953:c2205689-2205585 [Staphylococcus aureus subsp. aureus MSSA476]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT20616 NC_002953:2205492-2205530 [Staphylococcus aureus subsp. aureus MSSA476]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|