Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2827751..2827971 Replicon chromosome
Accession NZ_CP076645
Organism Escherichia coli strain MSI001

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag KP725_RS13815 Protein ID WP_000170963.1
Coordinates 2827864..2827971 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2827751..2827817 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP725_RS13790 2823026..2823721 - 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KP725_RS13795 2823879..2824109 - 231 WP_001146444.1 putative cation transport regulator ChaB -
KP725_RS13800 2824379..2825479 + 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
- 2825768..2825799 - 32 NuclAT_35 - -
- 2825768..2825799 - 32 NuclAT_35 - -
- 2825768..2825799 - 32 NuclAT_35 - -
- 2825768..2825799 - 32 NuclAT_35 - -
- 2825768..2825799 - 32 NuclAT_38 - -
- 2825768..2825799 - 32 NuclAT_38 - -
- 2825768..2825799 - 32 NuclAT_38 - -
- 2825768..2825799 - 32 NuclAT_38 - -
- 2825768..2825799 - 32 NuclAT_41 - -
- 2825768..2825799 - 32 NuclAT_41 - -
- 2825768..2825799 - 32 NuclAT_41 - -
- 2825768..2825799 - 32 NuclAT_41 - -
- 2825768..2825799 - 32 NuclAT_44 - -
- 2825768..2825799 - 32 NuclAT_44 - -
- 2825768..2825799 - 32 NuclAT_44 - -
- 2825768..2825799 - 32 NuclAT_44 - -
- 2825768..2825799 - 32 NuclAT_47 - -
- 2825768..2825799 - 32 NuclAT_47 - -
- 2825768..2825799 - 32 NuclAT_47 - -
- 2825768..2825799 - 32 NuclAT_47 - -
- 2825768..2825799 - 32 NuclAT_50 - -
- 2825768..2825799 - 32 NuclAT_50 - -
- 2825768..2825799 - 32 NuclAT_50 - -
- 2825768..2825799 - 32 NuclAT_50 - -
- 2825770..2825799 - 30 NuclAT_16 - -
- 2825770..2825799 - 30 NuclAT_16 - -
- 2825770..2825799 - 30 NuclAT_16 - -
- 2825770..2825799 - 30 NuclAT_16 - -
- 2825770..2825799 - 30 NuclAT_19 - -
- 2825770..2825799 - 30 NuclAT_19 - -
- 2825770..2825799 - 30 NuclAT_19 - -
- 2825770..2825799 - 30 NuclAT_19 - -
- 2825770..2825799 - 30 NuclAT_22 - -
- 2825770..2825799 - 30 NuclAT_22 - -
- 2825770..2825799 - 30 NuclAT_22 - -
- 2825770..2825799 - 30 NuclAT_22 - -
- 2825770..2825799 - 30 NuclAT_25 - -
- 2825770..2825799 - 30 NuclAT_25 - -
- 2825770..2825799 - 30 NuclAT_25 - -
- 2825770..2825799 - 30 NuclAT_25 - -
- 2825770..2825799 - 30 NuclAT_29 - -
- 2825770..2825799 - 30 NuclAT_29 - -
- 2825770..2825799 - 30 NuclAT_29 - -
- 2825770..2825799 - 30 NuclAT_29 - -
- 2825770..2825799 - 30 NuclAT_32 - -
- 2825770..2825799 - 30 NuclAT_32 - -
- 2825770..2825799 - 30 NuclAT_32 - -
- 2825770..2825799 - 30 NuclAT_32 - -
KP725_RS13805 2825847..2827216 + 1370 WP_085947770.1 IS3-like element IS150 family transposase -
- 2827238..2827281 - 44 NuclAT_34 - -
- 2827238..2827281 - 44 NuclAT_34 - -
- 2827238..2827281 - 44 NuclAT_34 - -
- 2827238..2827281 - 44 NuclAT_34 - -
- 2827238..2827281 - 44 NuclAT_37 - -
- 2827238..2827281 - 44 NuclAT_37 - -
- 2827238..2827281 - 44 NuclAT_37 - -
- 2827238..2827281 - 44 NuclAT_37 - -
- 2827238..2827281 - 44 NuclAT_40 - -
- 2827238..2827281 - 44 NuclAT_40 - -
- 2827238..2827281 - 44 NuclAT_40 - -
- 2827238..2827281 - 44 NuclAT_40 - -
- 2827238..2827281 - 44 NuclAT_43 - -
- 2827238..2827281 - 44 NuclAT_43 - -
- 2827238..2827281 - 44 NuclAT_43 - -
- 2827238..2827281 - 44 NuclAT_43 - -
- 2827238..2827281 - 44 NuclAT_46 - -
- 2827238..2827281 - 44 NuclAT_46 - -
- 2827238..2827281 - 44 NuclAT_46 - -
- 2827238..2827281 - 44 NuclAT_46 - -
- 2827238..2827281 - 44 NuclAT_49 - -
- 2827238..2827281 - 44 NuclAT_49 - -
- 2827238..2827281 - 44 NuclAT_49 - -
- 2827238..2827281 - 44 NuclAT_49 - -
KP725_RS13810 2827329..2827436 + 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2827751..2827817 - 67 - - Antitoxin
KP725_RS13815 2827864..2827971 + 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2828285..2828351 - 67 NuclAT_51 - -
- 2828285..2828351 - 67 NuclAT_51 - -
- 2828285..2828351 - 67 NuclAT_51 - -
- 2828285..2828351 - 67 NuclAT_51 - -
- 2828286..2828349 - 64 NuclAT_15 - -
- 2828286..2828349 - 64 NuclAT_15 - -
- 2828286..2828349 - 64 NuclAT_15 - -
- 2828286..2828349 - 64 NuclAT_15 - -
- 2828286..2828349 - 64 NuclAT_18 - -
- 2828286..2828349 - 64 NuclAT_18 - -
- 2828286..2828349 - 64 NuclAT_18 - -
- 2828286..2828349 - 64 NuclAT_18 - -
- 2828286..2828349 - 64 NuclAT_21 - -
- 2828286..2828349 - 64 NuclAT_21 - -
- 2828286..2828349 - 64 NuclAT_21 - -
- 2828286..2828349 - 64 NuclAT_21 - -
- 2828286..2828349 - 64 NuclAT_24 - -
- 2828286..2828349 - 64 NuclAT_24 - -
- 2828286..2828349 - 64 NuclAT_24 - -
- 2828286..2828349 - 64 NuclAT_24 - -
- 2828286..2828349 - 64 NuclAT_28 - -
- 2828286..2828349 - 64 NuclAT_28 - -
- 2828286..2828349 - 64 NuclAT_28 - -
- 2828286..2828349 - 64 NuclAT_28 - -
- 2828286..2828349 - 64 NuclAT_31 - -
- 2828286..2828349 - 64 NuclAT_31 - -
- 2828286..2828349 - 64 NuclAT_31 - -
- 2828286..2828349 - 64 NuclAT_31 - -
KP725_RS13820 2828399..2828506 + 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
KP725_RS13825 2828655..2829509 - 855 WP_216684034.1 3-deoxy-8-phosphooctulonate synthase -
KP725_RS13830 2829545..2830354 - 810 WP_001257044.1 invasion regulator SirB1 -
KP725_RS13835 2830358..2830750 - 393 WP_000200373.1 invasion regulator SirB2 -
KP725_RS13840 2830747..2831580 - 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
KP725_RS13845 2831580..2832662 - 1083 WP_000804726.1 peptide chain release factor 1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T206080 WP_000170963.1 NZ_CP076645:2827864-2827971 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T206080 NZ_CP076645:2827864-2827971 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT206080 NZ_CP076645:c2827817-2827751 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References