Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2827751..2827971 | Replicon | chromosome |
| Accession | NZ_CP076645 | ||
| Organism | Escherichia coli strain MSI001 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | KP725_RS13815 | Protein ID | WP_000170963.1 |
| Coordinates | 2827864..2827971 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2827751..2827817 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP725_RS13790 | 2823026..2823721 | - | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| KP725_RS13795 | 2823879..2824109 | - | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| KP725_RS13800 | 2824379..2825479 | + | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2825768..2825799 | - | 32 | NuclAT_35 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_35 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_35 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_35 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_38 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_38 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_38 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_38 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_41 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_41 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_41 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_41 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_44 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_44 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_44 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_44 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_47 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_47 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_47 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_47 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_50 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_50 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_50 | - | - |
| - | 2825768..2825799 | - | 32 | NuclAT_50 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_16 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_16 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_16 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_16 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_19 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_19 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_19 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_19 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_22 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_22 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_22 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_22 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_25 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_25 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_25 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_25 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_29 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_29 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_29 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_29 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_32 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_32 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_32 | - | - |
| - | 2825770..2825799 | - | 30 | NuclAT_32 | - | - |
| KP725_RS13805 | 2825847..2827216 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 2827238..2827281 | - | 44 | NuclAT_34 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_34 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_34 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_34 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_37 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_37 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_37 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_37 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_40 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_40 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_40 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_40 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_43 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_43 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_43 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_43 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_46 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_46 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_46 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_46 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_49 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_49 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_49 | - | - |
| - | 2827238..2827281 | - | 44 | NuclAT_49 | - | - |
| KP725_RS13810 | 2827329..2827436 | + | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2827751..2827817 | - | 67 | - | - | Antitoxin |
| KP725_RS13815 | 2827864..2827971 | + | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2828285..2828351 | - | 67 | NuclAT_51 | - | - |
| - | 2828285..2828351 | - | 67 | NuclAT_51 | - | - |
| - | 2828285..2828351 | - | 67 | NuclAT_51 | - | - |
| - | 2828285..2828351 | - | 67 | NuclAT_51 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_15 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_15 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_15 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_15 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_18 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_18 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_18 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_18 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_21 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_21 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_21 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_21 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_24 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_24 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_24 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_24 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_28 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_28 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_28 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_28 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_31 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_31 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_31 | - | - |
| - | 2828286..2828349 | - | 64 | NuclAT_31 | - | - |
| KP725_RS13820 | 2828399..2828506 | + | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| KP725_RS13825 | 2828655..2829509 | - | 855 | WP_216684034.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| KP725_RS13830 | 2829545..2830354 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| KP725_RS13835 | 2830358..2830750 | - | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
| KP725_RS13840 | 2830747..2831580 | - | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| KP725_RS13845 | 2831580..2832662 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T206080 WP_000170963.1 NZ_CP076645:2827864-2827971 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T206080 NZ_CP076645:2827864-2827971 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT206080 NZ_CP076645:c2827817-2827751 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|