Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1873356..1873538 | Replicon | chromosome |
| Accession | NC_002953 | ||
| Organism | Staphylococcus aureus subsp. aureus MSSA476 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAS_RS15060 | Protein ID | WP_001801861.1 |
| Coordinates | 1873356..1873451 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1873479..1873538 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAS_RS09155 | 1869026..1869652 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| SAS_RS09160 | 1869693..1870034 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| SAS_RS09165 | 1870135..1870707 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| SAS_RS09170 | 1870905..1871462 | - | 558 | Protein_1758 | ImmA/IrrE family metallo-endopeptidase | - |
| SAS_RS09180 | 1871836..1872012 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| SAS_RS09185 | 1872023..1872406 | - | 384 | WP_000070814.1 | hypothetical protein | - |
| SAS_RS09195 | 1873010..1873153 | - | 144 | WP_001549059.1 | transposase | - |
| SAS_RS15060 | 1873356..1873451 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1873479..1873538 | - | 60 | - | - | Antitoxin |
| SAS_RS09200 | 1873574..1873675 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SAS_RS14715 | 1873653..1873829 | - | 177 | Protein_1764 | transposase | - |
| SAS_RS09205 | 1874023..1874400 | - | 378 | Protein_1765 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T20606 WP_001801861.1 NC_002953:1873356-1873451 [Staphylococcus aureus subsp. aureus MSSA476]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T20606 NC_002953:1873356-1873451 [Staphylococcus aureus subsp. aureus MSSA476]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT20606 NC_002953:c1873538-1873479 [Staphylococcus aureus subsp. aureus MSSA476]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|