Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1231060..1231318 | Replicon | chromosome |
Accession | NZ_CP076596 | ||
Organism | Erwinia amylovora isolate CP20161301 |
Toxin (Protein)
Gene name | hok | Uniprot ID | D4I1C1 |
Locus tag | KQH32_RS05480 | Protein ID | WP_004160031.1 |
Coordinates | 1231060..1231218 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 1231272..1231318 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KQH32_RS05465 (KQH32_05505) | 1226365..1228056 | - | 1692 | WP_004160025.1 | chloride channel protein | - |
KQH32_RS05470 (KQH32_05510) | 1228469..1229449 | + | 981 | WP_013035818.1 | TerC family protein | - |
KQH32_RS05475 (KQH32_05515) | 1229684..1230916 | + | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
KQH32_RS05480 (KQH32_05520) | 1231060..1231218 | - | 159 | WP_004160031.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 1231272..1231318 | + | 47 | - | - | Antitoxin |
KQH32_RS05485 (KQH32_05525) | 1232029..1232703 | + | 675 | WP_004160034.1 | DedA family protein | - |
KQH32_RS05490 (KQH32_05530) | 1232700..1233092 | + | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
KQH32_RS05495 (KQH32_05535) | 1233260..1233631 | + | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
KQH32_RS05500 (KQH32_05540) | 1233674..1233979 | + | 306 | WP_004160037.1 | DUF883 family protein | - |
KQH32_RS05505 (KQH32_05545) | 1233981..1234373 | + | 393 | WP_004160038.1 | phage holin family protein | - |
KQH32_RS05510 (KQH32_05550) | 1234373..1234654 | + | 282 | WP_004160039.1 | YqjK-like family protein | - |
KQH32_RS05515 (KQH32_05555) | 1234864..1235256 | + | 393 | WP_004160048.1 | DoxX family protein | - |
KQH32_RS05520 (KQH32_05560) | 1235729..1235872 | + | 144 | WP_004160049.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6038.32 Da Isoelectric Point: 8.4901
>T206023 WP_004160031.1 NZ_CP076596:c1231218-1231060 [Erwinia amylovora]
MKLPANCLIWCVLIVCVTLLIFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
MKLPANCLIWCVLIVCVTLLIFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 159 bp
>T206023 NZ_CP102070:c2708780-2708637 [Enterococcus faecalis]
ATGAGCGTACTTCCAAAATTTACGGAAAGGAGAGGCCTTTTGTCAGCATATGAAACAATTCAGACGATCCTAGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAATAAAAAATAA
ATGAGCGTACTTCCAAAATTTACGGAAAGGAGAGGCCTTTTGTCAGCATATGAAACAATTCAGACGATCCTAGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAATAAAAAATAA
Antitoxin
Download Length: 47 bp
>AT206023 NZ_CP076596:1231272-1231318 [Erwinia amylovora]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|