Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2305998..2306214 | Replicon | chromosome |
| Accession | NC_002952 | ||
| Organism | Staphylococcus aureus subsp. aureus MRSA252 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | SAR_RS11665 | Protein ID | WP_073392962.1 |
| Coordinates | 2306110..2306214 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2305998..2306053 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAR_RS11645 | 2301090..2301410 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| SAR_RS11650 | 2301412..2302392 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
| SAR_RS11655 | 2302658..2303749 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
| SAR_RS11660 | 2304037..2305684 | + | 1648 | Protein_2213 | IS1182-like element ISSau3 family transposase | - |
| - | 2305998..2306053 | + | 56 | - | - | Antitoxin |
| SAR_RS11665 | 2306110..2306214 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
| SAR_RS15385 | 2306894..2307052 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| SAR_RS11670 | 2307711..2308568 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
| SAR_RS11675 | 2308636..2309418 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T20600 WP_073392962.1 NC_002952:c2306214-2306110 [Staphylococcus aureus subsp. aureus MRSA252]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T20600 NC_002952:c2306214-2306110 [Staphylococcus aureus subsp. aureus MRSA252]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT20600 NC_002952:2305998-2306053 [Staphylococcus aureus subsp. aureus MRSA252]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|