Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2966397..2966655 | Replicon | chromosome |
| Accession | NZ_CP076590 | ||
| Organism | Erwinia amylovora isolate CP200930 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | D4I1C1 |
| Locus tag | KQH39_RS13620 | Protein ID | WP_004160031.1 |
| Coordinates | 2966397..2966555 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 2966609..2966655 (+) |
Genomic Context
Location: 2963806..2964786 (981 bp)
Type: Others
Protein ID: WP_013035818.1
Type: Others
Protein ID: WP_013035818.1
Location: 2965021..2966253 (1233 bp)
Type: Others
Protein ID: WP_004160030.1
Type: Others
Protein ID: WP_004160030.1
Location: 2966609..2966655 (47 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2967366..2968040 (675 bp)
Type: Others
Protein ID: WP_004160034.1
Type: Others
Protein ID: WP_004160034.1
Location: 2968037..2968429 (393 bp)
Type: Others
Protein ID: WP_004160035.1
Type: Others
Protein ID: WP_004160035.1
Location: 2968597..2968968 (372 bp)
Type: Others
Protein ID: WP_004160036.1
Type: Others
Protein ID: WP_004160036.1
Location: 2969011..2969316 (306 bp)
Type: Others
Protein ID: WP_004160037.1
Type: Others
Protein ID: WP_004160037.1
Location: 2969318..2969710 (393 bp)
Type: Others
Protein ID: WP_004160038.1
Type: Others
Protein ID: WP_004160038.1
Location: 2969710..2969991 (282 bp)
Type: Others
Protein ID: WP_004160039.1
Type: Others
Protein ID: WP_004160039.1
Location: 2970201..2970593 (393 bp)
Type: Others
Protein ID: WP_004160048.1
Type: Others
Protein ID: WP_004160048.1
Location: 2971066..2971209 (144 bp)
Type: Others
Protein ID: WP_004160049.1
Type: Others
Protein ID: WP_004160049.1
Location: 2961702..2963393 (1692 bp)
Type: Others
Protein ID: WP_004160025.1
Type: Others
Protein ID: WP_004160025.1
Location: 2966397..2966555 (159 bp)
Type: Toxin
Protein ID: WP_004160031.1
Type: Toxin
Protein ID: WP_004160031.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KQH39_RS13605 (KQH39_13645) | 2961702..2963393 | - | 1692 | WP_004160025.1 | chloride channel protein | - |
| KQH39_RS13610 (KQH39_13650) | 2963806..2964786 | + | 981 | WP_013035818.1 | TerC family protein | - |
| KQH39_RS13615 (KQH39_13655) | 2965021..2966253 | + | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
| KQH39_RS13620 (KQH39_13660) | 2966397..2966555 | - | 159 | WP_004160031.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2966609..2966655 | + | 47 | - | - | Antitoxin |
| KQH39_RS13625 (KQH39_13665) | 2967366..2968040 | + | 675 | WP_004160034.1 | DedA family protein | - |
| KQH39_RS13630 (KQH39_13670) | 2968037..2968429 | + | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
| KQH39_RS13635 (KQH39_13675) | 2968597..2968968 | + | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
| KQH39_RS13640 (KQH39_13680) | 2969011..2969316 | + | 306 | WP_004160037.1 | DUF883 family protein | - |
| KQH39_RS13645 (KQH39_13685) | 2969318..2969710 | + | 393 | WP_004160038.1 | phage holin family protein | - |
| KQH39_RS13650 (KQH39_13690) | 2969710..2969991 | + | 282 | WP_004160039.1 | YqjK-like family protein | - |
| KQH39_RS13655 (KQH39_13695) | 2970201..2970593 | + | 393 | WP_004160048.1 | DoxX family protein | - |
| KQH39_RS13660 (KQH39_13700) | 2971066..2971209 | + | 144 | WP_004160049.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6038.32 Da Isoelectric Point: 8.4901
>T205979 WP_004160031.1 NZ_CP076590:c2966555-2966397 [Erwinia amylovora]
MKLPANCLIWCVLIVCVTLLIFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
MKLPANCLIWCVLIVCVTLLIFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 159 bp
>T205979 NZ_CP101986:165647-165979 [Streptococcus mutans]
GTGGTAACCATCAAGCAAGGGTCAATTATCAAAATTAACTTGGATCCCAAACAAGGACATGAACAAAAAGGGTATCGTCC
GTACATTTGTCTAAACCATAGTATCGTAACCAAGTATTCTAATATTGCTATTTTTGCGCCAATTAGCAATACCAAGCGTG
ATTACCCTTTTTATGTTCCCCTAGAAGGAACAGAATCCACAGGGAAAGTATTATTAGACCAACTGGTTACAATCGATTTT
AATGCTAGAGATTATCGTTATGTGGAGGATATTCAGGAAGACTTATTAGATGAACTTTTAGCTAGGGTCAAGGTGCTATT
TGAAAAAGGATAA
GTGGTAACCATCAAGCAAGGGTCAATTATCAAAATTAACTTGGATCCCAAACAAGGACATGAACAAAAAGGGTATCGTCC
GTACATTTGTCTAAACCATAGTATCGTAACCAAGTATTCTAATATTGCTATTTTTGCGCCAATTAGCAATACCAAGCGTG
ATTACCCTTTTTATGTTCCCCTAGAAGGAACAGAATCCACAGGGAAAGTATTATTAGACCAACTGGTTACAATCGATTTT
AATGCTAGAGATTATCGTTATGTGGAGGATATTCAGGAAGACTTATTAGATGAACTTTTAGCTAGGGTCAAGGTGCTATT
TGAAAAAGGATAA
Antitoxin
Download Length: 47 bp
>AT205979 NZ_CP076590:2966609-2966655 [Erwinia amylovora]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A831A7I1 |
Antitoxin
Download structure file