Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2130108..2130407 | Replicon | chromosome |
| Accession | NC_002952 | ||
| Organism | Staphylococcus aureus subsp. aureus MRSA252 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | SAR_RS15320 | Protein ID | WP_011447039.1 |
| Coordinates | 2130231..2130407 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2130108..2130163 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAR_RS10625 | 2125437..2125697 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| SAR_RS10630 | 2125750..2126100 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAR_RS10635 | 2126786..2127235 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| SAR_RS15695 | 2127330..2127665 | - | 336 | Protein_2017 | SH3 domain-containing protein | - |
| SAR_RS10645 | 2128315..2128806 | - | 492 | WP_000919350.1 | staphylokinase | - |
| SAR_RS10650 | 2128998..2129753 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAR_RS10655 | 2129765..2130019 | - | 255 | WP_000611512.1 | phage holin | - |
| SAR_RS10660 | 2130071..2130178 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2130100..2130239 | + | 140 | NuclAT_0 | - | - |
| - | 2130100..2130239 | + | 140 | NuclAT_0 | - | - |
| - | 2130100..2130239 | + | 140 | NuclAT_0 | - | - |
| - | 2130100..2130239 | + | 140 | NuclAT_0 | - | - |
| - | 2130108..2130163 | + | 56 | - | - | Antitoxin |
| SAR_RS15320 | 2130231..2130407 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| SAR_RS10670 | 2130516..2131289 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| SAR_RS10675 | 2131710..2132084 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| SAR_RS10680 | 2132140..2132427 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| SAR_RS10685 | 2132474..2132626 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / groEL | 2119976..2178968 | 58992 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T20596 WP_011447039.1 NC_002952:c2130407-2130231 [Staphylococcus aureus subsp. aureus MRSA252]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T20596 NC_002952:c2130407-2130231 [Staphylococcus aureus subsp. aureus MRSA252]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT20596 NC_002952:2130108-2130163 [Staphylococcus aureus subsp. aureus MRSA252]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|