Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2217054..2217312 | Replicon | chromosome |
Accession | NZ_CP076527 | ||
Organism | Escherichia coli strain L3452210II |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | KPE21_RS10800 | Protein ID | WP_000809168.1 |
Coordinates | 2217160..2217312 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 2217054..2217111 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KPE21_RS24255 | 2212102..2213433 | + | 1332 | Protein_2117 | fimbria/pilus outer membrane usher protein | - |
KPE21_RS10785 | 2213446..2214404 | + | 959 | Protein_2118 | fimbrial family protein | - |
KPE21_RS10790 | 2214443..2215342 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
KPE21_RS10795 | 2215408..2216574 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
- | 2217054..2217111 | - | 58 | - | - | Antitoxin |
KPE21_RS10800 | 2217160..2217312 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
KPE21_RS10805 | 2217416..2218546 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
KPE21_RS10810 | 2218635..2220551 | - | 1917 | WP_000516131.1 | molecular chaperone DnaK | - |
KPE21_RS10815 | 2220928..2221332 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
KPE21_RS10820 | 2221358..2222071 | + | 714 | WP_001102383.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T205922 WP_000809168.1 NZ_CP076527:2217160-2217312 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T205922 NZ_CP101925:2833342-2833449 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCGTGATTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTTGGCTGGTGGCGTAGCCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCGTGATTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTTGGCTGGTGGCGTAGCCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT205922 NZ_CP076527:c2217111-2217054 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|