Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1972690..1972870 | Replicon | chromosome |
Accession | NC_002952 | ||
Organism | Staphylococcus aureus subsp. aureus MRSA252 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAR_RS15670 | Protein ID | WP_001801861.1 |
Coordinates | 1972690..1972785 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1972813..1972870 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAR_RS09645 | 1967834..1968460 | + | 627 | WP_000669038.1 | hypothetical protein | - |
SAR_RS09650 | 1968501..1968845 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
SAR_RS09655 | 1968943..1969515 | + | 573 | WP_000414222.1 | hypothetical protein | - |
SAR_RS09660 | 1969664..1971031 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
SAR_RS09665 | 1971031..1971600 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAR_RS09670 | 1971793..1972239 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
SAR_RS15670 | 1972690..1972785 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1972813..1972870 | - | 58 | - | - | Antitoxin |
SAR_RS09675 | 1972908..1973009 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAR_RS09680 | 1973184..1973627 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
SAR_RS09685 | 1973627..1974070 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
SAR_RS15250 | 1974070..1974512 | - | 443 | Protein_1870 | DUF1433 domain-containing protein | - |
SAR_RS09695 | 1975037..1977457 | + | 2421 | WP_000182553.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T20592 WP_001801861.1 NC_002952:1972690-1972785 [Staphylococcus aureus subsp. aureus MRSA252]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T20592 NC_002952:1972690-1972785 [Staphylococcus aureus subsp. aureus MRSA252]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT20592 NC_002952:c1972870-1972813 [Staphylococcus aureus subsp. aureus MRSA252]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|