Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 415..629 | Replicon | plasmid pUAMSEL1 |
| Accession | NZ_CP076494 | ||
| Organism | Enterococcus faecalis strain UAMS_EL54 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | KPU55_RS14935 | Protein ID | WP_002360667.1 |
| Coordinates | 519..629 (-) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 415..479 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 415..479 | + | 65 | - | - | Antitoxin |
| KPU55_RS14935 | 519..629 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| KPU55_RS14940 | 711..923 | - | 213 | Protein_2 | excinuclease ABC subunit C | - |
| KPU55_RS14945 | 880..1230 | - | 351 | WP_002360672.1 | hypothetical protein | - |
| KPU55_RS14950 | 1227..2555 | - | 1329 | WP_129268066.1 | ultraviolet resistance protein UvrA | - |
| KPU55_RS14955 | 2984..3286 | - | 303 | WP_002372577.1 | DUF6440 family protein | - |
| KPU55_RS14960 | 3298..3507 | - | 210 | WP_002382045.1 | hypothetical protein | - |
| KPU55_RS14965 | 3568..3792 | - | 225 | WP_002383635.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| KPU55_RS14970 | 3786..4100 | - | 315 | WP_002383634.1 | hypothetical protein | - |
| KPU55_RS14975 | 4090..4197 | - | 108 | Protein_9 | recombinase family protein | - |
| KPU55_RS14980 | 4271..5432 | + | 1162 | Protein_10 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-III / ant(6)-Ia / erm(B) | cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 | 1..119714 | 119714 | |
| - | flank | IS/Tn | - | - | 4596..5432 | 836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T205831 WP_002360667.1 NZ_CP076494:c629-519 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T205831 NZ_CP101915:1978467-1978570 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 65 bp
>AT205831 NZ_CP076494:415-479 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|