Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1357318..1357538 Replicon chromosome
Accession NZ_CP076274
Organism Escherichia coli strain P393-F10

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag A7A10_RS06660 Protein ID WP_000170965.1
Coordinates 1357318..1357425 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1357472..1357538 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A7A10_RS06630 1352627..1353709 + 1083 WP_000804726.1 peptide chain release factor 1 -
A7A10_RS06635 1353709..1354542 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
A7A10_RS06640 1354539..1354931 + 393 WP_000200378.1 invasion regulator SirB2 -
A7A10_RS06645 1354935..1355744 + 810 WP_001257044.1 invasion regulator SirB1 -
A7A10_RS06650 1355780..1356634 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
A7A10_RS06655 1356783..1356890 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1356938..1357004 + 67 NuclAT_45 - -
- 1356938..1357004 + 67 NuclAT_45 - -
- 1356938..1357004 + 67 NuclAT_45 - -
- 1356938..1357004 + 67 NuclAT_45 - -
- 1356938..1357004 + 67 NuclAT_48 - -
- 1356938..1357004 + 67 NuclAT_48 - -
- 1356938..1357004 + 67 NuclAT_48 - -
- 1356938..1357004 + 67 NuclAT_48 - -
- 1356940..1357003 + 64 NuclAT_17 - -
- 1356940..1357003 + 64 NuclAT_17 - -
- 1356940..1357003 + 64 NuclAT_17 - -
- 1356940..1357003 + 64 NuclAT_17 - -
- 1356940..1357003 + 64 NuclAT_20 - -
- 1356940..1357003 + 64 NuclAT_20 - -
- 1356940..1357003 + 64 NuclAT_20 - -
- 1356940..1357003 + 64 NuclAT_20 - -
- 1356940..1357003 + 64 NuclAT_23 - -
- 1356940..1357003 + 64 NuclAT_23 - -
- 1356940..1357003 + 64 NuclAT_23 - -
- 1356940..1357003 + 64 NuclAT_23 - -
- 1356940..1357003 + 64 NuclAT_26 - -
- 1356940..1357003 + 64 NuclAT_26 - -
- 1356940..1357003 + 64 NuclAT_26 - -
- 1356940..1357003 + 64 NuclAT_26 - -
- 1356940..1357003 + 64 NuclAT_29 - -
- 1356940..1357003 + 64 NuclAT_29 - -
- 1356940..1357003 + 64 NuclAT_29 - -
- 1356940..1357003 + 64 NuclAT_29 - -
- 1356940..1357003 + 64 NuclAT_32 - -
- 1356940..1357003 + 64 NuclAT_32 - -
- 1356940..1357003 + 64 NuclAT_32 - -
- 1356940..1357003 + 64 NuclAT_32 - -
A7A10_RS06660 1357318..1357425 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1357472..1357538 + 67 - - Antitoxin
A7A10_RS06665 1357853..1357960 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1358008..1358073 + 66 NuclAT_16 - -
- 1358008..1358073 + 66 NuclAT_16 - -
- 1358008..1358073 + 66 NuclAT_16 - -
- 1358008..1358073 + 66 NuclAT_16 - -
- 1358008..1358073 + 66 NuclAT_19 - -
- 1358008..1358073 + 66 NuclAT_19 - -
- 1358008..1358073 + 66 NuclAT_19 - -
- 1358008..1358073 + 66 NuclAT_19 - -
- 1358008..1358073 + 66 NuclAT_22 - -
- 1358008..1358073 + 66 NuclAT_22 - -
- 1358008..1358073 + 66 NuclAT_22 - -
- 1358008..1358073 + 66 NuclAT_22 - -
- 1358008..1358073 + 66 NuclAT_25 - -
- 1358008..1358073 + 66 NuclAT_25 - -
- 1358008..1358073 + 66 NuclAT_25 - -
- 1358008..1358073 + 66 NuclAT_25 - -
- 1358008..1358073 + 66 NuclAT_28 - -
- 1358008..1358073 + 66 NuclAT_28 - -
- 1358008..1358073 + 66 NuclAT_28 - -
- 1358008..1358073 + 66 NuclAT_28 - -
- 1358008..1358073 + 66 NuclAT_31 - -
- 1358008..1358073 + 66 NuclAT_31 - -
- 1358008..1358073 + 66 NuclAT_31 - -
- 1358008..1358073 + 66 NuclAT_31 - -
- 1358008..1358075 + 68 NuclAT_34 - -
- 1358008..1358075 + 68 NuclAT_34 - -
- 1358008..1358075 + 68 NuclAT_34 - -
- 1358008..1358075 + 68 NuclAT_34 - -
- 1358008..1358075 + 68 NuclAT_36 - -
- 1358008..1358075 + 68 NuclAT_36 - -
- 1358008..1358075 + 68 NuclAT_36 - -
- 1358008..1358075 + 68 NuclAT_36 - -
- 1358008..1358075 + 68 NuclAT_38 - -
- 1358008..1358075 + 68 NuclAT_38 - -
- 1358008..1358075 + 68 NuclAT_38 - -
- 1358008..1358075 + 68 NuclAT_38 - -
- 1358008..1358075 + 68 NuclAT_40 - -
- 1358008..1358075 + 68 NuclAT_40 - -
- 1358008..1358075 + 68 NuclAT_40 - -
- 1358008..1358075 + 68 NuclAT_40 - -
- 1358008..1358075 + 68 NuclAT_42 - -
- 1358008..1358075 + 68 NuclAT_42 - -
- 1358008..1358075 + 68 NuclAT_42 - -
- 1358008..1358075 + 68 NuclAT_42 - -
- 1358008..1358075 + 68 NuclAT_44 - -
- 1358008..1358075 + 68 NuclAT_44 - -
- 1358008..1358075 + 68 NuclAT_44 - -
- 1358008..1358075 + 68 NuclAT_44 - -
- 1358009..1358074 + 66 NuclAT_47 - -
- 1358009..1358074 + 66 NuclAT_47 - -
- 1358009..1358074 + 66 NuclAT_47 - -
- 1358009..1358074 + 66 NuclAT_47 - -
- 1358009..1358074 + 66 NuclAT_50 - -
- 1358009..1358074 + 66 NuclAT_50 - -
- 1358009..1358074 + 66 NuclAT_50 - -
- 1358009..1358074 + 66 NuclAT_50 - -
A7A10_RS06670 1358365..1359465 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
A7A10_RS06675 1359735..1359965 + 231 WP_001146442.1 putative cation transport regulator ChaB -
A7A10_RS06680 1360123..1360818 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
A7A10_RS06685 1360862..1361215 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T205218 WP_000170965.1 NZ_CP076274:c1357425-1357318 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T205218 NZ_CP101513:839871-840278 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA

Antitoxin


Download         Length: 67 bp

>AT205218 NZ_CP076274:1357472-1357538 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References