Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1357318..1357538 | Replicon | chromosome |
| Accession | NZ_CP076274 | ||
| Organism | Escherichia coli strain P393-F10 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | A7A10_RS06660 | Protein ID | WP_000170965.1 |
| Coordinates | 1357318..1357425 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1357472..1357538 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7A10_RS06630 | 1352627..1353709 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| A7A10_RS06635 | 1353709..1354542 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| A7A10_RS06640 | 1354539..1354931 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| A7A10_RS06645 | 1354935..1355744 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| A7A10_RS06650 | 1355780..1356634 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| A7A10_RS06655 | 1356783..1356890 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1356938..1357004 | + | 67 | NuclAT_45 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_45 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_45 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_45 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_48 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_48 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_48 | - | - |
| - | 1356938..1357004 | + | 67 | NuclAT_48 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_17 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_17 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_17 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_17 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_20 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_20 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_20 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_20 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_23 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_23 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_23 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_23 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_26 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_26 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_26 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_26 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_29 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_29 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_29 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_29 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_32 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_32 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_32 | - | - |
| - | 1356940..1357003 | + | 64 | NuclAT_32 | - | - |
| A7A10_RS06660 | 1357318..1357425 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1357472..1357538 | + | 67 | - | - | Antitoxin |
| A7A10_RS06665 | 1357853..1357960 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1358008..1358073 | + | 66 | NuclAT_16 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_16 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_16 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_16 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_19 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_19 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_19 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_19 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_22 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_22 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_22 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_22 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_25 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_25 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_25 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_25 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_28 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_28 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_28 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_28 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_31 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_31 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_31 | - | - |
| - | 1358008..1358073 | + | 66 | NuclAT_31 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_34 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_34 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_34 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_34 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_36 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_36 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_36 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_36 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_38 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_38 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_38 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_38 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_40 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_40 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_40 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_40 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_42 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_42 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_42 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_42 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_44 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_44 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_44 | - | - |
| - | 1358008..1358075 | + | 68 | NuclAT_44 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_47 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_47 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_47 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_47 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_50 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_50 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_50 | - | - |
| - | 1358009..1358074 | + | 66 | NuclAT_50 | - | - |
| A7A10_RS06670 | 1358365..1359465 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| A7A10_RS06675 | 1359735..1359965 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| A7A10_RS06680 | 1360123..1360818 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| A7A10_RS06685 | 1360862..1361215 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T205218 WP_000170965.1 NZ_CP076274:c1357425-1357318 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T205218 NZ_CP101513:839871-840278 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA
Antitoxin
Download Length: 67 bp
>AT205218 NZ_CP076274:1357472-1357538 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|