Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1368256..1368476 Replicon chromosome
Accession NZ_CP076259
Organism Escherichia coli strain WY517-2

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag A7A20_RS06575 Protein ID WP_000170965.1
Coordinates 1368256..1368363 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1368410..1368476 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
A7A20_RS06545 1364111..1364944 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
A7A20_RS06550 1364941..1365333 + 393 WP_000200378.1 invasion regulator SirB2 -
A7A20_RS06555 1365337..1366146 + 810 WP_001257044.1 invasion regulator SirB1 -
A7A20_RS06560 1366182..1367036 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
A7A20_RS06565 1367185..1367292 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1367340..1367406 + 67 NuclAT_45 - -
- 1367340..1367406 + 67 NuclAT_45 - -
- 1367340..1367406 + 67 NuclAT_45 - -
- 1367340..1367406 + 67 NuclAT_45 - -
- 1367340..1367406 + 67 NuclAT_48 - -
- 1367340..1367406 + 67 NuclAT_48 - -
- 1367340..1367406 + 67 NuclAT_48 - -
- 1367340..1367406 + 67 NuclAT_48 - -
- 1367342..1367405 + 64 NuclAT_17 - -
- 1367342..1367405 + 64 NuclAT_17 - -
- 1367342..1367405 + 64 NuclAT_17 - -
- 1367342..1367405 + 64 NuclAT_17 - -
- 1367342..1367405 + 64 NuclAT_20 - -
- 1367342..1367405 + 64 NuclAT_20 - -
- 1367342..1367405 + 64 NuclAT_20 - -
- 1367342..1367405 + 64 NuclAT_20 - -
- 1367342..1367405 + 64 NuclAT_23 - -
- 1367342..1367405 + 64 NuclAT_23 - -
- 1367342..1367405 + 64 NuclAT_23 - -
- 1367342..1367405 + 64 NuclAT_23 - -
- 1367342..1367405 + 64 NuclAT_26 - -
- 1367342..1367405 + 64 NuclAT_26 - -
- 1367342..1367405 + 64 NuclAT_26 - -
- 1367342..1367405 + 64 NuclAT_26 - -
- 1367342..1367405 + 64 NuclAT_29 - -
- 1367342..1367405 + 64 NuclAT_29 - -
- 1367342..1367405 + 64 NuclAT_29 - -
- 1367342..1367405 + 64 NuclAT_29 - -
- 1367342..1367405 + 64 NuclAT_32 - -
- 1367342..1367405 + 64 NuclAT_32 - -
- 1367342..1367405 + 64 NuclAT_32 - -
- 1367342..1367405 + 64 NuclAT_32 - -
A7A20_RS06570 1367720..1367827 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1367880..1367941 + 62 NuclAT_16 - -
- 1367880..1367941 + 62 NuclAT_16 - -
- 1367880..1367941 + 62 NuclAT_16 - -
- 1367880..1367941 + 62 NuclAT_16 - -
- 1367880..1367941 + 62 NuclAT_19 - -
- 1367880..1367941 + 62 NuclAT_19 - -
- 1367880..1367941 + 62 NuclAT_19 - -
- 1367880..1367941 + 62 NuclAT_19 - -
- 1367880..1367941 + 62 NuclAT_22 - -
- 1367880..1367941 + 62 NuclAT_22 - -
- 1367880..1367941 + 62 NuclAT_22 - -
- 1367880..1367941 + 62 NuclAT_22 - -
- 1367880..1367941 + 62 NuclAT_25 - -
- 1367880..1367941 + 62 NuclAT_25 - -
- 1367880..1367941 + 62 NuclAT_25 - -
- 1367880..1367941 + 62 NuclAT_25 - -
- 1367880..1367941 + 62 NuclAT_28 - -
- 1367880..1367941 + 62 NuclAT_28 - -
- 1367880..1367941 + 62 NuclAT_28 - -
- 1367880..1367941 + 62 NuclAT_28 - -
- 1367880..1367941 + 62 NuclAT_31 - -
- 1367880..1367941 + 62 NuclAT_31 - -
- 1367880..1367941 + 62 NuclAT_31 - -
- 1367880..1367941 + 62 NuclAT_31 - -
- 1367880..1367942 + 63 NuclAT_46 - -
- 1367880..1367942 + 63 NuclAT_46 - -
- 1367880..1367942 + 63 NuclAT_46 - -
- 1367880..1367942 + 63 NuclAT_46 - -
- 1367880..1367942 + 63 NuclAT_49 - -
- 1367880..1367942 + 63 NuclAT_49 - -
- 1367880..1367942 + 63 NuclAT_49 - -
- 1367880..1367942 + 63 NuclAT_49 - -
- 1367880..1367943 + 64 NuclAT_34 - -
- 1367880..1367943 + 64 NuclAT_34 - -
- 1367880..1367943 + 64 NuclAT_34 - -
- 1367880..1367943 + 64 NuclAT_34 - -
- 1367880..1367943 + 64 NuclAT_36 - -
- 1367880..1367943 + 64 NuclAT_36 - -
- 1367880..1367943 + 64 NuclAT_36 - -
- 1367880..1367943 + 64 NuclAT_36 - -
- 1367880..1367943 + 64 NuclAT_38 - -
- 1367880..1367943 + 64 NuclAT_38 - -
- 1367880..1367943 + 64 NuclAT_38 - -
- 1367880..1367943 + 64 NuclAT_38 - -
- 1367880..1367943 + 64 NuclAT_40 - -
- 1367880..1367943 + 64 NuclAT_40 - -
- 1367880..1367943 + 64 NuclAT_40 - -
- 1367880..1367943 + 64 NuclAT_40 - -
- 1367880..1367943 + 64 NuclAT_42 - -
- 1367880..1367943 + 64 NuclAT_42 - -
- 1367880..1367943 + 64 NuclAT_42 - -
- 1367880..1367943 + 64 NuclAT_42 - -
- 1367880..1367943 + 64 NuclAT_44 - -
- 1367880..1367943 + 64 NuclAT_44 - -
- 1367880..1367943 + 64 NuclAT_44 - -
- 1367880..1367943 + 64 NuclAT_44 - -
A7A20_RS06575 1368256..1368363 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1368410..1368476 + 67 - - Antitoxin
A7A20_RS06580 1368768..1369868 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
A7A20_RS06585 1370138..1370368 + 231 WP_001146442.1 putative cation transport regulator ChaB -
A7A20_RS06590 1370526..1371221 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
A7A20_RS06595 1371265..1371618 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
A7A20_RS06600 1371803..1373197 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T205022 WP_000170965.1 NZ_CP076259:c1368363-1368256 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T205022 NZ_CP101369:c2123798-2123487 [Salmonella enterica]
ATGCATGTCATATCAAAAGAGCCTTTTGATGAAGCGGCAAGACGATATCCCAATGACTCGTTAGCCATAAAAGCCCTGTA
TCGCTTAGTCCGCGAAAAAGATTTCTCTTCTCCGGCAGAGCTACGAAAGGTCATACCGAGTCTCGATAACTTTAAGTACC
GTAACAAGTGGTGGGTACTGGATGTCGGAGGCAACAACCTGAGGGTGATCGCTTACATCAACTTTATAAACAAACGCTTT
TATGTGAAACACATCGCCACTCACGCTGAATATGACAAGCTGACCCGCTACTACAGGGAGAATAAAGAATGA

Antitoxin


Download         Length: 67 bp

>AT205022 NZ_CP076259:1368410-1368476 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References