Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1368256..1368476 | Replicon | chromosome |
| Accession | NZ_CP076259 | ||
| Organism | Escherichia coli strain WY517-2 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | A7A20_RS06575 | Protein ID | WP_000170965.1 |
| Coordinates | 1368256..1368363 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1368410..1368476 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7A20_RS06545 | 1364111..1364944 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| A7A20_RS06550 | 1364941..1365333 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| A7A20_RS06555 | 1365337..1366146 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| A7A20_RS06560 | 1366182..1367036 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| A7A20_RS06565 | 1367185..1367292 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1367340..1367406 | + | 67 | NuclAT_45 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_45 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_45 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_45 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_48 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_48 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_48 | - | - |
| - | 1367340..1367406 | + | 67 | NuclAT_48 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_17 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_17 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_17 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_17 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_20 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_20 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_20 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_20 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_23 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_23 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_23 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_23 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_26 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_26 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_26 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_26 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_29 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_29 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_29 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_29 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_32 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_32 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_32 | - | - |
| - | 1367342..1367405 | + | 64 | NuclAT_32 | - | - |
| A7A20_RS06570 | 1367720..1367827 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1367880..1367941 | + | 62 | NuclAT_16 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_16 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_16 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_16 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_19 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_19 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_19 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_19 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_22 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_22 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_22 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_22 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_25 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_25 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_25 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_25 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_28 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_28 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_28 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_28 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_31 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_31 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_31 | - | - |
| - | 1367880..1367941 | + | 62 | NuclAT_31 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_46 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_46 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_46 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_46 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_49 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_49 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_49 | - | - |
| - | 1367880..1367942 | + | 63 | NuclAT_49 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_34 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_34 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_34 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_34 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_36 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_36 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_36 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_36 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_38 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_38 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_38 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_38 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_40 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_40 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_40 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_40 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_42 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_42 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_42 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_42 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_44 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_44 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_44 | - | - |
| - | 1367880..1367943 | + | 64 | NuclAT_44 | - | - |
| A7A20_RS06575 | 1368256..1368363 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1368410..1368476 | + | 67 | - | - | Antitoxin |
| A7A20_RS06580 | 1368768..1369868 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| A7A20_RS06585 | 1370138..1370368 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| A7A20_RS06590 | 1370526..1371221 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| A7A20_RS06595 | 1371265..1371618 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| A7A20_RS06600 | 1371803..1373197 | + | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T205022 WP_000170965.1 NZ_CP076259:c1368363-1368256 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T205022 NZ_CP101369:c2123798-2123487 [Salmonella enterica]
ATGCATGTCATATCAAAAGAGCCTTTTGATGAAGCGGCAAGACGATATCCCAATGACTCGTTAGCCATAAAAGCCCTGTA
TCGCTTAGTCCGCGAAAAAGATTTCTCTTCTCCGGCAGAGCTACGAAAGGTCATACCGAGTCTCGATAACTTTAAGTACC
GTAACAAGTGGTGGGTACTGGATGTCGGAGGCAACAACCTGAGGGTGATCGCTTACATCAACTTTATAAACAAACGCTTT
TATGTGAAACACATCGCCACTCACGCTGAATATGACAAGCTGACCCGCTACTACAGGGAGAATAAAGAATGA
ATGCATGTCATATCAAAAGAGCCTTTTGATGAAGCGGCAAGACGATATCCCAATGACTCGTTAGCCATAAAAGCCCTGTA
TCGCTTAGTCCGCGAAAAAGATTTCTCTTCTCCGGCAGAGCTACGAAAGGTCATACCGAGTCTCGATAACTTTAAGTACC
GTAACAAGTGGTGGGTACTGGATGTCGGAGGCAACAACCTGAGGGTGATCGCTTACATCAACTTTATAAACAAACGCTTT
TATGTGAAACACATCGCCACTCACGCTGAATATGACAAGCTGACCCGCTACTACAGGGAGAATAAAGAATGA
Antitoxin
Download Length: 67 bp
>AT205022 NZ_CP076259:1368410-1368476 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|