Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3484600..3484825 | Replicon | chromosome |
| Accession | NZ_CP076235 | ||
| Organism | Escherichia coli O157:H7 strain 9.1_Anguil | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | JKN68_RS18015 | Protein ID | WP_000813263.1 |
| Coordinates | 3484600..3484755 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3484767..3484825 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JKN68_RS17980 | 3480054..3480767 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| JKN68_RS17985 | 3480905..3481101 | - | 197 | Protein_3515 | TrmB family transcriptional regulator | - |
| JKN68_RS17990 | 3481388..3482206 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| JKN68_RS17995 | 3482358..3482729 | - | 372 | WP_000090264.1 | antiterminator Q family protein | - |
| JKN68_RS18000 | 3482719..3483090 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JKN68_RS18005 | 3483103..3484152 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| JKN68_RS18010 | 3484154..3484432 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| JKN68_RS18015 | 3484600..3484755 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3484767..3484825 | + | 59 | - | - | Antitoxin |
| JKN68_RS18020 | 3485015..3485098 | - | 84 | Protein_3522 | ORF6N domain-containing protein | - |
| JKN68_RS18025 | 3485360..3486133 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| JKN68_RS18030 | 3486485..3486898 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| JKN68_RS18035 | 3486914..3487684 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| JKN68_RS18040 | 3487706..3488452 | - | 747 | WP_000788745.1 | ATP-binding protein | - |
| JKN68_RS18045 | 3488459..3489550 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T204850 WP_000813263.1 NZ_CP076235:c3484755-3484600 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T204850 NZ_CP101269:2042420-2042523 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 59 bp
>AT204850 NZ_CP076235:3484767-3484825 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|