Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2562485..2562669 | Replicon | chromosome |
Accession | NC_002758 | ||
Organism | Staphylococcus aureus subsp. aureus Mu50 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | SAV_RS13255 | Protein ID | WP_000482652.1 |
Coordinates | 2562562..2562669 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2562485..2562545 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAV_RS13230 | 2557940..2558107 | - | 168 | Protein_2487 | hypothetical protein | - |
SAV_RS13240 | 2558338..2560071 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
SAV_RS13245 | 2560096..2561859 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2562485..2562545 | + | 61 | - | - | Antitoxin |
SAV_RS13255 | 2562562..2562669 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAV_RS13260 | 2562803..2563189 | - | 387 | WP_000779360.1 | flippase GtxA | - |
SAV_RS13265 | 2563457..2564599 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAV_RS13270 | 2564659..2565318 | + | 660 | WP_000831298.1 | membrane protein | - |
SAV_RS13275 | 2565500..2566711 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAV_RS13280 | 2566834..2567307 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T20480 WP_000482652.1 NC_002758:c2562669-2562562 [Staphylococcus aureus subsp. aureus Mu50]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T20480 NC_002758:c2562669-2562562 [Staphylococcus aureus subsp. aureus Mu50]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT20480 NC_002758:2562485-2562545 [Staphylococcus aureus subsp. aureus Mu50]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|