Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1934328..1934508 | Replicon | chromosome |
Accession | NC_002758 | ||
Organism | Staphylococcus aureus subsp. aureus Mu50 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAV_RS15670 | Protein ID | WP_001801861.1 |
Coordinates | 1934328..1934423 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1934451..1934508 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAV_RS09650 | 1929491..1930141 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
SAV_RS09655 | 1930222..1931217 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
SAV_RS09660 | 1931292..1931918 | + | 627 | WP_000669024.1 | hypothetical protein | - |
SAV_RS09665 | 1931959..1932300 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
SAV_RS09670 | 1932401..1932973 | + | 573 | WP_000414216.1 | hypothetical protein | - |
SAV_RS15275 | 1933171..1934183 | - | 1013 | Protein_1838 | IS3 family transposase | - |
SAV_RS15670 | 1934328..1934423 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1934451..1934508 | - | 58 | - | - | Antitoxin |
SAV_RS09690 | 1934546..1934647 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SAV_RS15675 | 1934625..1934786 | - | 162 | Protein_1841 | transposase | - |
SAV_RS09695 | 1934777..1935271 | - | 495 | Protein_1842 | transposase | - |
SAV_RS09700 | 1935723..1936952 | - | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
SAV_RS09705 | 1936945..1938501 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
SAV_RS09710 | 1938665..1938799 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1910310..1961342 | 51032 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T20468 WP_001801861.1 NC_002758:1934328-1934423 [Staphylococcus aureus subsp. aureus Mu50]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T20468 NC_002758:1934328-1934423 [Staphylococcus aureus subsp. aureus Mu50]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT20468 NC_002758:c1934508-1934451 [Staphylococcus aureus subsp. aureus Mu50]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|