Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1794886..1795068 | Replicon | chromosome |
| Accession | NZ_CP076105 | ||
| Organism | Staphylococcus aureus subsp. aureus RN4220 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | KMZ21_RS08590 | Protein ID | WP_001801861.1 |
| Coordinates | 1794886..1794981 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1795009..1795068 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KMZ21_RS08550 (KMZ21_08550) | 1790546..1791172 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| KMZ21_RS08555 (KMZ21_08555) | 1791213..1791557 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| KMZ21_RS08560 (KMZ21_08560) | 1791655..1792206 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| KMZ21_RS08565 (KMZ21_08565) | 1792424..1793065 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KMZ21_RS08570 (KMZ21_08570) | 1793179..1793364 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| KMZ21_RS08575 (KMZ21_08575) | 1793366..1793542 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| KMZ21_RS08580 (KMZ21_08580) | 1793553..1793936 | - | 384 | WP_000070812.1 | hypothetical protein | - |
| KMZ21_RS08585 (KMZ21_08585) | 1794540..1794683 | - | 144 | WP_001549059.1 | transposase | - |
| KMZ21_RS08590 (KMZ21_08590) | 1794886..1794981 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1795009..1795068 | - | 60 | - | - | Antitoxin |
| KMZ21_RS08595 (KMZ21_08595) | 1795104..1795205 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| KMZ21_RS08600 (KMZ21_08600) | 1795183..1795359 | - | 177 | Protein_1690 | transposase | - |
| KMZ21_RS08605 (KMZ21_08605) | 1795553..1795930 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T204628 WP_001801861.1 NZ_CP076105:1794886-1794981 [Staphylococcus aureus subsp. aureus RN4220]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T204628 NZ_CP101176:c4594415-4594281 [Xanthomonas campestris pv. campestris]
ATGAAGCGTGCAATTGCATTGTTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCCGCGCGCAAGTGA
ATGAAGCGTGCAATTGCATTGTTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCCGCGCGCAAGTGA
Antitoxin
Download Length: 60 bp
>AT204628 NZ_CP076105:c1795068-1795009 [Staphylococcus aureus subsp. aureus RN4220]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|