Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 347589..348003 | Replicon | chromosome |
Accession | NZ_CP076029 | ||
Organism | Staphylococcus sp. MZ9 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | KI244_RS01790 | Protein ID | WP_025174939.1 |
Coordinates | 347589..347840 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KI244_RS01795 | Protein ID | WP_000028424.1 |
Coordinates | 347830..348003 (+) | Length | 58 a.a. |
Genomic Context
Location: 342819..343247 (429 bp)
Type: Others
Protein ID: WP_000934385.1
Type: Others
Protein ID: WP_000934385.1
Location: 343261..343935 (675 bp)
Type: Others
Protein ID: WP_001124439.1
Type: Others
Protein ID: WP_001124439.1
Location: 343932..344081 (150 bp)
Type: Others
Protein ID: WP_001081076.1
Type: Others
Protein ID: WP_001081076.1
Location: 344421..345191 (771 bp)
Type: Others
Protein ID: WP_000190253.1
Type: Others
Protein ID: WP_000190253.1
Location: 345201..345980 (780 bp)
Type: Others
Protein ID: WP_000803062.1
Type: Others
Protein ID: WP_000803062.1
Location: 345974..346132 (159 bp)
Type: Others
Protein ID: WP_000256590.1
Type: Others
Protein ID: WP_000256590.1
Location: 346145..346366 (222 bp)
Type: Others
Protein ID: WP_001123685.1
Type: Others
Protein ID: WP_001123685.1
Location: 346377..346781 (405 bp)
Type: Others
Protein ID: WP_000049810.1
Type: Others
Protein ID: WP_000049810.1
Location: 346786..346971 (186 bp)
Type: Others
Protein ID: WP_049317452.1
Type: Others
Protein ID: WP_049317452.1
Location: 346972..347328 (357 bp)
Type: Others
Protein ID: WP_000029369.1
Type: Others
Protein ID: WP_000029369.1
Location: 347332..347574 (243 bp)
Type: Others
Protein ID: WP_000131381.1
Type: Others
Protein ID: WP_000131381.1
Location: 347589..347840 (252 bp)
Type: Toxin
Protein ID: WP_025174939.1
Type: Toxin
Protein ID: WP_025174939.1
Location: 347830..348003 (174 bp)
Type: Antitoxin
Protein ID: WP_000028424.1
Type: Antitoxin
Protein ID: WP_000028424.1
Location: 348004..348285 (282 bp)
Type: Others
Protein ID: WP_000454994.1
Type: Others
Protein ID: WP_000454994.1
Location: 348286..348447 (162 bp)
Type: Others
Protein ID: WP_000889683.1
Type: Others
Protein ID: WP_000889683.1
Location: 348462..348995 (534 bp)
Type: Others
Protein ID: WP_025920701.1
Type: Others
Protein ID: WP_025920701.1
Location: 349032..349238 (207 bp)
Type: Others
Protein ID: WP_000195827.1
Type: Others
Protein ID: WP_000195827.1
Location: 349235..349429 (195 bp)
Type: Others
Protein ID: Protein_347
Type: Others
Protein ID: Protein_347
Location: 349426..349629 (204 bp)
Type: Others
Protein ID: WP_001072795.1
Type: Others
Protein ID: WP_001072795.1
Location: 349622..349858 (237 bp)
Type: Others
Protein ID: WP_000608278.1
Type: Others
Protein ID: WP_000608278.1
Location: 349851..350024 (174 bp)
Type: Others
Protein ID: WP_000595257.1
Type: Others
Protein ID: WP_000595257.1
Location: 350025..350171 (147 bp)
Type: Others
Protein ID: WP_000990005.1
Type: Others
Protein ID: WP_000990005.1
Location: 350195..350617 (423 bp)
Type: Others
Protein ID: WP_000162701.1
Type: Others
Protein ID: WP_000162701.1
Location: 350805..351299 (495 bp)
Type: Others
Protein ID: WP_001038244.1
Type: Others
Protein ID: WP_001038244.1
Location: 351302..352597 (1296 bp)
Type: Others
Protein ID: WP_117172029.1
Type: Others
Protein ID: WP_117172029.1
Location: 344074..344355 (282 bp)
Type: Others
Protein ID: WP_000414755.1
Type: Others
Protein ID: WP_000414755.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KI244_RS01730 (KI244_01730) | 342819..343247 | + | 429 | WP_000934385.1 | single-stranded DNA-binding protein | - |
KI244_RS01735 (KI244_01735) | 343261..343935 | + | 675 | WP_001124439.1 | putative HNHc nuclease | - |
KI244_RS01740 (KI244_01740) | 343932..344081 | + | 150 | WP_001081076.1 | hypothetical protein | - |
KI244_RS01745 (KI244_01745) | 344074..344355 | - | 282 | WP_000414755.1 | hypothetical protein | - |
KI244_RS01750 (KI244_01750) | 344421..345191 | + | 771 | WP_000190253.1 | conserved phage C-terminal domain-containing protein | - |
KI244_RS01755 (KI244_01755) | 345201..345980 | + | 780 | WP_000803062.1 | ATP-binding protein | - |
KI244_RS01760 (KI244_01760) | 345974..346132 | + | 159 | WP_000256590.1 | hypothetical protein | - |
KI244_RS01765 (KI244_01765) | 346145..346366 | + | 222 | WP_001123685.1 | DUF3269 family protein | - |
KI244_RS01770 (KI244_01770) | 346377..346781 | + | 405 | WP_000049810.1 | DUF1064 domain-containing protein | - |
KI244_RS01775 (KI244_01775) | 346786..346971 | + | 186 | WP_049317452.1 | DUF3113 family protein | - |
KI244_RS01780 (KI244_01780) | 346972..347328 | + | 357 | WP_000029369.1 | SA1788 family PVL leukocidin-associated protein | - |
KI244_RS01785 (KI244_01785) | 347332..347574 | + | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
KI244_RS01790 (KI244_01790) | 347589..347840 | + | 252 | WP_025174939.1 | DUF1024 family protein | Toxin |
KI244_RS01795 (KI244_01795) | 347830..348003 | + | 174 | WP_000028424.1 | hypothetical protein | Antitoxin |
KI244_RS01800 (KI244_01800) | 348004..348285 | + | 282 | WP_000454994.1 | hypothetical protein | - |
KI244_RS01805 (KI244_01805) | 348286..348447 | + | 162 | WP_000889683.1 | hypothetical protein | - |
KI244_RS01810 (KI244_01810) | 348462..348995 | + | 534 | WP_025920701.1 | dUTP diphosphatase | - |
KI244_RS01815 (KI244_01815) | 349032..349238 | + | 207 | WP_000195827.1 | DUF1381 domain-containing protein | - |
KI244_RS01820 (KI244_01820) | 349235..349429 | + | 195 | Protein_347 | hypothetical protein | - |
KI244_RS01825 (KI244_01825) | 349426..349629 | + | 204 | WP_001072795.1 | hypothetical protein | - |
KI244_RS01830 (KI244_01830) | 349622..349858 | + | 237 | WP_000608278.1 | hypothetical protein | - |
KI244_RS01835 (KI244_01835) | 349851..350024 | + | 174 | WP_000595257.1 | transcriptional activator RinB | - |
KI244_RS01840 (KI244_01840) | 350025..350171 | + | 147 | WP_000990005.1 | hypothetical protein | - |
KI244_RS01845 (KI244_01845) | 350195..350617 | + | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
KI244_RS01850 (KI244_01850) | 350805..351299 | + | 495 | WP_001038244.1 | terminase small subunit | - |
KI244_RS01855 (KI244_01855) | 351302..352597 | + | 1296 | WP_117172029.1 | PBSX family phage terminase large subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | eta | 334046..377602 | 43556 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9361.22 Da Isoelectric Point: 3.8464
>T204568 WP_025174939.1 NZ_CP076029:347589-347840 [Staphylococcus sp. MZ9]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILDGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEY
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILDGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEY
Download Length: 252 bp
>T204568 NZ_CP100765:c4269076-4268654 [Serratia nematodiphila]
GTGGCCCAGTGGCGATGTGATATCCGCATTTCCTGGCGCACCCAGCTGTTTTCACTGTTAACCCACGGCGTTCTGATCCT
GCTGATCCTGATTTCGCCCTGGCCGGAAGGCTTTGGCCCGCTCTGGCTGGTGCTGCTGACGCTGGTGGTGTTTCAGTGCA
TTCGCAGCCAGAAGCGCATCGCCGCGGTGCAGGGCGAGCTGCGGCTGCTGGCGGATCGGCGTTTCAGCTGGCACGGCCGC
GAGTGGCGACTGGCGAAAAAACCGTGGATGCCGGGTTACGGCATGCTGTTGACGCTGCAGCCGATGGAAGGCAAAAAGCG
CCGCCGGCTGTGGCTGGCTTCCGACTGCATGAGCAAAGAGGAATGGCGCCACCTGCGGCAGCTGTTGCTGTATCCGCCGG
CGGGTGACGGCGAGGAATCCTGA
GTGGCCCAGTGGCGATGTGATATCCGCATTTCCTGGCGCACCCAGCTGTTTTCACTGTTAACCCACGGCGTTCTGATCCT
GCTGATCCTGATTTCGCCCTGGCCGGAAGGCTTTGGCCCGCTCTGGCTGGTGCTGCTGACGCTGGTGGTGTTTCAGTGCA
TTCGCAGCCAGAAGCGCATCGCCGCGGTGCAGGGCGAGCTGCGGCTGCTGGCGGATCGGCGTTTCAGCTGGCACGGCCGC
GAGTGGCGACTGGCGAAAAAACCGTGGATGCCGGGTTACGGCATGCTGTTGACGCTGCAGCCGATGGAAGGCAAAAAGCG
CCGCCGGCTGTGGCTGGCTTCCGACTGCATGAGCAAAGAGGAATGGCGCCACCTGCGGCAGCTGTTGCTGTATCCGCCGG
CGGGTGACGGCGAGGAATCCTGA
Antitoxin
Download Length: 58 a.a. Molecular weight: 6468.29 Da Isoelectric Point: 4.2484
>AT204568 WP_000028424.1 NZ_CP076029:347830-348003 [Staphylococcus sp. MZ9]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE
Download Length: 174 bp
>AT204568 NZ_CP100765:c4269323-4269057 [Serratia nematodiphila]
ATGGATATTAACAACAAAGCACGTATTCACTGGGCTTGCCGCCGTGGCATGCGCGAGCTGGACATTTCCATCATGCCGTT
CTTCGAATACGAATACGACAGCCTGAATGACGCGGACAAGGCGCTGTTTATCCGCCTGCTGGAGTGCGACGATCCCGATT
TGTTCAACTGGCTGATGAATCATGGCGCGCCGCAGGACGGCGAGCTGCAGAGAATGGTGACCCTGATCCAAACGCGAAAT
AAAGACCGTGGCCCAGTGGCGATGTGA
ATGGATATTAACAACAAAGCACGTATTCACTGGGCTTGCCGCCGTGGCATGCGCGAGCTGGACATTTCCATCATGCCGTT
CTTCGAATACGAATACGACAGCCTGAATGACGCGGACAAGGCGCTGTTTATCCGCCTGCTGGAGTGCGACGATCCCGATT
TGTTCAACTGGCTGATGAATCATGGCGCGCCGCAGGACGGCGAGCTGCAGAGAATGGTGACCCTGATCCAAACGCGAAAT
AAAGACCGTGGCCCAGTGGCGATGTGA