Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 879209..879623 Replicon chromosome
Accession NZ_CP076026
Organism Staphylococcus sp. MZ3

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag KI230_RS04235 Protein ID WP_025174939.1
Coordinates 879209..879460 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag KI230_RS04240 Protein ID WP_000028424.1
Coordinates 879450..879623 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KI230_RS04175 (KI230_04175) 874439..874867 + 429 WP_000934385.1 single-stranded DNA-binding protein -
KI230_RS04180 (KI230_04180) 874881..875555 + 675 WP_001124439.1 putative HNHc nuclease -
KI230_RS04185 (KI230_04185) 875552..875701 + 150 WP_001081076.1 hypothetical protein -
KI230_RS04190 (KI230_04190) 875694..875975 - 282 WP_000414755.1 hypothetical protein -
KI230_RS04195 (KI230_04195) 876041..876811 + 771 WP_000190253.1 conserved phage C-terminal domain-containing protein -
KI230_RS04200 (KI230_04200) 876821..877600 + 780 WP_000803062.1 ATP-binding protein -
KI230_RS04205 (KI230_04205) 877594..877752 + 159 WP_000256590.1 hypothetical protein -
KI230_RS04210 (KI230_04210) 877765..877986 + 222 WP_001123685.1 DUF3269 family protein -
KI230_RS04215 (KI230_04215) 877997..878401 + 405 WP_000049810.1 DUF1064 domain-containing protein -
KI230_RS04220 (KI230_04220) 878406..878591 + 186 WP_049317452.1 DUF3113 family protein -
KI230_RS04225 (KI230_04225) 878592..878948 + 357 WP_000029369.1 SA1788 family PVL leukocidin-associated protein -
KI230_RS04230 (KI230_04230) 878952..879194 + 243 WP_000131381.1 phi PVL orf 51-like protein -
KI230_RS04235 (KI230_04235) 879209..879460 + 252 WP_025174939.1 DUF1024 family protein Toxin
KI230_RS04240 (KI230_04240) 879450..879623 + 174 WP_000028424.1 hypothetical protein Antitoxin
KI230_RS04245 (KI230_04245) 879624..879905 + 282 WP_000454994.1 hypothetical protein -
KI230_RS04250 (KI230_04250) 879906..880067 + 162 WP_000889683.1 hypothetical protein -
KI230_RS04255 (KI230_04255) 880082..880615 + 534 WP_025920701.1 dUTP diphosphatase -
KI230_RS04260 (KI230_04260) 880652..880858 + 207 WP_000195827.1 DUF1381 domain-containing protein -
KI230_RS04265 (KI230_04265) 880855..881049 + 195 Protein_836 hypothetical protein -
KI230_RS04270 (KI230_04270) 881046..881249 + 204 WP_001072795.1 hypothetical protein -
KI230_RS04275 (KI230_04275) 881242..881478 + 237 WP_000608278.1 hypothetical protein -
KI230_RS04280 (KI230_04280) 881471..881644 + 174 WP_000595257.1 transcriptional activator RinB -
KI230_RS04285 (KI230_04285) 881645..881791 + 147 WP_000990005.1 hypothetical protein -
KI230_RS04290 (KI230_04290) 881815..882237 + 423 WP_000162701.1 RinA family phage transcriptional activator -
KI230_RS04295 (KI230_04295) 882425..882919 + 495 WP_001038244.1 terminase small subunit -
KI230_RS04300 (KI230_04300) 882922..884217 + 1296 WP_117172029.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - eta 865051..911616 46565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9361.22 Da        Isoelectric Point: 3.8464

>T204534 WP_025174939.1 NZ_CP076026:879209-879460 [Staphylococcus sp. MZ3]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILDGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEY

Download         Length: 252 bp

>T204534 NZ_CP100753:c2730919-2730823 [Serratia marcescens]
AACAAGCCCTGCATTAAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTAGACCGAATATAGGAATC
GTATTCGGTCTTTTTTT

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT204534 WP_000028424.1 NZ_CP076026:879450-879623 [Staphylococcus sp. MZ3]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp

>AT204534 NZ_CP100753:2730823-2730963 [Serratia marcescens]
AAAAAAAGACCGAATACGATTCCTATATTCGGTCTAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCAT
TTAATGCAGGGCTTGTTCAGCCGTGCACTTTAAGAGTAGCCTACCGCGCCAGTTTTGCCAG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References