Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 98696..98965 | Replicon | plasmid pSTEC2018_607-a |
Accession | NZ_CP075698 | ||
Organism | Escherichia coli strain STEC2018-607 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | JFX52_RS25975 | Protein ID | WP_001372321.1 |
Coordinates | 98840..98965 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 98696..98761 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JFX52_RS28395 | 93798..94079 | + | 282 | WP_071829438.1 | hypothetical protein | - |
JFX52_RS28400 | 94320..94526 | + | 207 | WP_052078239.1 | hypothetical protein | - |
JFX52_RS25945 | 94552..95004 | + | 453 | WP_000290842.1 | single-stranded DNA-binding protein | - |
JFX52_RS25950 | 95066..95299 | + | 234 | WP_001519997.1 | DUF905 family protein | - |
JFX52_RS25955 | 95364..97322 | + | 1959 | WP_063072993.1 | ParB/RepB/Spo0J family partition protein | - |
JFX52_RS25960 | 97377..97811 | + | 435 | WP_000845907.1 | conjugation system SOS inhibitor PsiB | - |
JFX52_RS25965 | 97808..98570 | + | 763 | Protein_101 | plasmid SOS inhibition protein A | - |
JFX52_RS25970 | 98539..98727 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 98539..98763 | + | 225 | NuclAT_0 | - | - |
- | 98539..98763 | + | 225 | NuclAT_0 | - | - |
- | 98539..98763 | + | 225 | NuclAT_0 | - | - |
- | 98539..98763 | + | 225 | NuclAT_0 | - | - |
- | 98696..98761 | - | 66 | - | - | Antitoxin |
JFX52_RS28405 | 98749..98898 | + | 150 | Protein_103 | plasmid maintenance protein Mok | - |
JFX52_RS25975 | 98840..98965 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JFX52_RS28410 | 99185..99415 | + | 231 | WP_071845785.1 | hypothetical protein | - |
JFX52_RS28415 | 99413..99586 | - | 174 | Protein_106 | hypothetical protein | - |
JFX52_RS25980 | 99656..99862 | + | 207 | WP_033804333.1 | hypothetical protein | - |
JFX52_RS25985 | 99887..100174 | + | 288 | WP_000107542.1 | hypothetical protein | - |
JFX52_RS25990 | 100293..101114 | + | 822 | WP_033804334.1 | DUF932 domain-containing protein | - |
JFX52_RS25995 | 101411..101722 | - | 312 | Protein_110 | transglycosylase SLT domain-containing protein | - |
JFX52_RS26000 | 101778..102475 | + | 698 | WP_223429336.1 | IS1 family transposase | - |
JFX52_RS26005 | 102491..102829 | + | 339 | Protein_112 | MFS transporter | - |
JFX52_RS26010 | 102845..103666 | + | 822 | WP_198777264.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | hlyC / hlyA / hlyB / hlyD / espP | 1..106835 | 106835 | |
- | flank | IS/Tn | - | - | 101972..102475 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T204262 WP_001372321.1 NZ_CP075698:98840-98965 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T204262 NZ_CP100687:7051-7305 [Salmonella enterica subsp. enterica serovar Goldcoast]
ATGAGAAAAAACAAAGGGCGATTGACTTATTATCTTGAAGTGATTGATAAAAAATACCATTTTGTAAAAAAAATAAGCAG
TTATTCAAAGGAGTTCACTGACGGAAAAACAAAAAGAACAAAGAGAACGTTAAGTGAGCTGGTTTTTAATGAAAGTGAGG
TCGAGGCAATAGACTTTACAAAAAATGGTTTAAGACCTGTTGATAAGAATATTCTCTTAACTATGGTGAAAGAATATAAG
GAGAGTGATGCATGA
ATGAGAAAAAACAAAGGGCGATTGACTTATTATCTTGAAGTGATTGATAAAAAATACCATTTTGTAAAAAAAATAAGCAG
TTATTCAAAGGAGTTCACTGACGGAAAAACAAAAAGAACAAAGAGAACGTTAAGTGAGCTGGTTTTTAATGAAAGTGAGG
TCGAGGCAATAGACTTTACAAAAAATGGTTTAAGACCTGTTGATAAGAATATTCTCTTAACTATGGTGAAAGAATATAAG
GAGAGTGATGCATGA
Antitoxin
Download Length: 66 bp
>AT204262 NZ_CP075698:c98761-98696 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|