Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44480..44734 | Replicon | plasmid pSTEC17_183-a |
| Accession | NZ_CP075653 | ||
| Organism | Escherichia coli strain STEC17-183 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | JFX43_RS24960 | Protein ID | WP_001312851.1 |
| Coordinates | 44480..44629 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 44678..44734 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JFX43_RS24925 (39884) | 39884..40342 | + | 459 | Protein_44 | IS110 family transposase | - |
| JFX43_RS24930 (40972) | 40972..41106 | - | 135 | Protein_45 | TieB | - |
| JFX43_RS24935 (41259) | 41259..41540 | - | 282 | WP_000780223.1 | helix-turn-helix transcriptional regulator | - |
| JFX43_RS24940 (41521) | 41521..41850 | - | 330 | WP_000493283.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JFX43_RS24945 (42787) | 42787..43644 | - | 858 | WP_000131008.1 | incFII family plasmid replication initiator RepA | - |
| JFX43_RS24950 (43637) | 43637..43711 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| JFX43_RS24955 (43936) | 43936..44196 | - | 261 | WP_000083819.1 | replication regulatory protein RepA | - |
| JFX43_RS24960 (44480) | 44480..44629 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (44678) | 44678..44734 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (44678) | 44678..44734 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (44678) | 44678..44734 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (44678) | 44678..44734 | + | 57 | NuclAT_1 | - | Antitoxin |
| JFX43_RS24965 (44909) | 44909..45292 | - | 384 | WP_001109065.1 | hypothetical protein | - |
| JFX43_RS24970 (45395) | 45395..45856 | - | 462 | WP_000760081.1 | thermonuclease family protein | - |
| JFX43_RS26690 (46598) | 46598..46801 | - | 204 | WP_001336517.1 | hypothetical protein | - |
| JFX43_RS24975 (46955) | 46955..47512 | - | 558 | WP_000139316.1 | fertility inhibition protein FinO | - |
| JFX43_RS24980 (47615) | 47615..48475 | - | 861 | WP_000704512.1 | alpha/beta hydrolase | - |
| JFX43_RS24985 (48534) | 48534..49280 | - | 747 | WP_000205775.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyD / hlyD / hlyB / hlyB / hlyA / hlyA / hlyA / hlyA / hlyC | 1..111930 | 111930 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T204144 WP_001312851.1 NZ_CP075653:c44629-44480 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T204144 NZ_CP100596:c2654557-2654414 [Enterococcus faecalis]
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAAACAATTCAGACGATCCTAGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAATAAAAAATAA
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAAACAATTCAGACGATCCTAGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAATAAAAAATAA
Antitoxin
Download Length: 57 bp
>AT204144 NZ_CP075653:44678-44734 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
