Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 119513..119767 | Replicon | plasmid pSTEC2018_166-a |
| Accession | NZ_CP075633 | ||
| Organism | Escherichia coli strain 2018-166 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | JFX80_RS26315 | Protein ID | WP_001312851.1 |
| Coordinates | 119618..119767 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 119513..119569 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JFX80_RS26285 (114967) | 114967..115713 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| JFX80_RS26290 (115772) | 115772..116632 | + | 861 | WP_000704512.1 | alpha/beta hydrolase | - |
| JFX80_RS26295 (116735) | 116735..117292 | + | 558 | WP_000139316.1 | fertility inhibition protein FinO | - |
| JFX80_RS26300 (117446) | 117446..117649 | + | 204 | WP_001336517.1 | hypothetical protein | - |
| JFX80_RS26305 (118391) | 118391..118852 | + | 462 | WP_000760081.1 | thermonuclease family protein | - |
| JFX80_RS26310 (118940) | 118940..119338 | + | 399 | WP_000675594.1 | hypothetical protein | - |
| - (119513) | 119513..119569 | - | 57 | NuclAT_0 | - | Antitoxin |
| - (119513) | 119513..119569 | - | 57 | NuclAT_0 | - | Antitoxin |
| - (119513) | 119513..119569 | - | 57 | NuclAT_0 | - | Antitoxin |
| - (119513) | 119513..119569 | - | 57 | NuclAT_0 | - | Antitoxin |
| JFX80_RS26315 (119618) | 119618..119767 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| JFX80_RS26320 (120051) | 120051..120311 | + | 261 | WP_000083819.1 | replication regulatory protein RepA | - |
| JFX80_RS27480 (120404) | 120404..120589 | + | 186 | Protein_125 | plasmid copy control protein CopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | senB / hlyC / hlyA / hlyB / hlyD / iutA / iucD / iucC / iucB / iucA | 1..120601 | 120601 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T204043 WP_001312851.1 NZ_CP075633:119618-119767 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T204043 NZ_CP100520:1890308-1890410 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 57 bp
>AT204043 NZ_CP075633:c119569-119513 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|