Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2491305..2491489 | Replicon | chromosome |
Accession | NC_002745 | ||
Organism | Staphylococcus aureus subsp. aureus N315 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | SA_RS12740 | Protein ID | WP_000482652.1 |
Coordinates | 2491382..2491489 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2491305..2491365 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA_RS12715 | 2486760..2486927 | - | 168 | Protein_2383 | hypothetical protein | - |
SA_RS12725 (SA2216) | 2487158..2488891 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
SA_RS12730 (SA2217) | 2488916..2490679 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2491305..2491365 | + | 61 | - | - | Antitoxin |
SA_RS12740 | 2491382..2491489 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SA_RS12745 (SA2219) | 2491623..2492009 | - | 387 | WP_000779360.1 | flippase GtxA | - |
SA_RS12750 (SA2220) | 2492277..2493419 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SA_RS12755 (SA2221) | 2493479..2494138 | + | 660 | WP_000831298.1 | membrane protein | - |
SA_RS12760 (SA2222) | 2494320..2495531 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SA_RS12765 (SA2223) | 2495654..2496127 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T20396 WP_000482652.1 NC_002745:c2491489-2491382 [Staphylococcus aureus subsp. aureus N315]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T20396 NC_002745:c2491489-2491382 [Staphylococcus aureus subsp. aureus N315]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT20396 NC_002745:2491305-2491365 [Staphylococcus aureus subsp. aureus N315]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|