Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2206432..2206648 | Replicon | chromosome |
Accession | NC_002745 | ||
Organism | Staphylococcus aureus subsp. aureus N315 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SA_RS11230 | Protein ID | WP_001802298.1 |
Coordinates | 2206544..2206648 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2206432..2206487 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA_RS11210 (SA1953) | 2201983..2202360 | - | 378 | WP_000361059.1 | transposase | - |
SA_RS11215 (SA1954) | 2202367..2204259 | - | 1893 | WP_001557544.1 | site-specific integrase | - |
SA_RS11220 (SA1955) | 2204256..2205341 | - | 1086 | WP_000868132.1 | tyrosine-type recombinase/integrase | - |
SA_RS11225 (SA1956) | 2205467..2206111 | + | 645 | Protein_2097 | transcriptional regulator | - |
- | 2206432..2206487 | + | 56 | - | - | Antitoxin |
SA_RS11230 | 2206544..2206648 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SA_RS14875 | 2207328..2207486 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SA_RS11235 (SA1957) | 2208144..2209001 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
SA_RS11240 (SA1958) | 2209069..2209851 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T20393 WP_001802298.1 NC_002745:c2206648-2206544 [Staphylococcus aureus subsp. aureus N315]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T20393 NC_002745:c2206648-2206544 [Staphylococcus aureus subsp. aureus N315]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT20393 NC_002745:2206432-2206487 [Staphylococcus aureus subsp. aureus N315]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|