Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 4509353..4509574 | Replicon | chromosome |
| Accession | NC_002655 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | Z_RS31045 | Protein ID | WP_001295224.1 |
| Coordinates | 4509353..4509460 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 4509509..4509574 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Z_RS23255 (Z4949) | 4504606..4505358 | - | 753 | Protein_4426 | cellulose biosynthesis protein BcsQ | - |
| Z_RS23265 (Z4951) | 4505370..4505558 | - | 189 | WP_001063316.1 | YhjR family protein | - |
| Z_RS23270 (Z4952) | 4505831..4507402 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| Z_RS23275 (Z4953) | 4507399..4507590 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| Z_RS23280 (Z4954) | 4507587..4509266 | + | 1680 | WP_000191598.1 | cellulose biosynthesis protein BcsG | - |
| Z_RS31045 | 4509353..4509460 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4509509..4509574 | + | 66 | - | - | Antitoxin |
| Z_RS23295 (Z4956) | 4509936..4511207 | + | 1272 | WP_010904940.1 | amino acid permease | - |
| Z_RS23300 (Z4957) | 4511237..4512241 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| Z_RS23305 (Z4958) | 4512238..4513221 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| Z_RS23310 (Z4959) | 4513232..4514134 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T20338 WP_001295224.1 NC_002655:c4509460-4509353 [Escherichia coli O157:H7 str. EDL933]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T20338 NC_002655:c4509460-4509353 [Escherichia coli O157:H7 str. EDL933]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT20338 NC_002655:4509509-4509574 [Escherichia coli O157:H7 str. EDL933]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|