Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47256..47525 | Replicon | plasmid R100 |
| Accession | NC_002134 | ||
| Organism | Shigella flexneri 2b | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | HXF40_RS00290 | Protein ID | WP_001372321.1 |
| Coordinates | 47400..47525 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 47256..47321 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HXF40_RS00260 (D742_p2083) | 42856..43449 | - | 594 | WP_000428546.1 | tetracyline resistance-associated transcriptional repressor TetC | - |
| HXF40_RS00265 (D742_p2082) | 43537..43953 | + | 417 | WP_000275180.1 | AraC family transcriptional regulator | - |
| HXF40_RS00270 (D742_p2015) | 43963..45171 | - | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
| HXF40_RS00275 (D742_p2003) | 45281..45868 | + | 588 | Protein_54 | hypothetical protein | - |
| HXF40_RS00280 (D742_p2091) | 45937..46371 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| HXF40_RS00285 (D742_p2092) | 46368..47087 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 47256..47321 | + | 66 | - | - | Antitoxin |
| HXF40_RS00580 | 47309..47458 | + | 150 | Protein_57 | plasmid maintenance protein Mok | - |
| HXF40_RS00290 (D742_p2111) | 47400..47525 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HXF40_RS00295 (D742_p2002) | 47844..48140 | - | 297 | Protein_59 | hypothetical protein | - |
| HXF40_RS00300 (D742_p2001) | 48440..48736 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| HXF40_RS00305 (D742_p2116) | 48847..49668 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| HXF40_RS00310 (D742_p2045) | 49965..50567 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| HXF40_RS00315 (D742_p2066) | 50890..51273 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HXF40_RS00320 (D742_p2069) | 51467..52138 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| HXF40_RS00325 (D742_p2055) | 52275..52502 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / catA1 / tet(B) | - | 1..94281 | 94281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T20269 WP_001372321.1 NC_002134:47400-47525 [Shigella flexneri 2b]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T20269 NC_002134:47400-47525 [Shigella flexneri 2b]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT20269 NC_002134:47256-47321 [Shigella flexneri 2b]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|