Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2672713..2672933 Replicon chromosome
Accession NZ_CP074680
Organism Escherichia coli strain MEI008

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag KIM92_RS12920 Protein ID WP_000170965.1
Coordinates 2672826..2672933 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2672713..2672779 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KIM92_RS12895 2667992..2669386 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
KIM92_RS12900 2669571..2669924 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
KIM92_RS12905 2669968..2670663 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
KIM92_RS12910 2670821..2671051 - 231 WP_001146442.1 putative cation transport regulator ChaB -
KIM92_RS12915 2671321..2672421 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2672713..2672779 - 67 - - Antitoxin
KIM92_RS12920 2672826..2672933 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2673246..2673309 - 64 NuclAT_35 - -
- 2673246..2673309 - 64 NuclAT_35 - -
- 2673246..2673309 - 64 NuclAT_35 - -
- 2673246..2673309 - 64 NuclAT_35 - -
- 2673246..2673309 - 64 NuclAT_38 - -
- 2673246..2673309 - 64 NuclAT_38 - -
- 2673246..2673309 - 64 NuclAT_38 - -
- 2673246..2673309 - 64 NuclAT_38 - -
- 2673246..2673309 - 64 NuclAT_41 - -
- 2673246..2673309 - 64 NuclAT_41 - -
- 2673246..2673309 - 64 NuclAT_41 - -
- 2673246..2673309 - 64 NuclAT_41 - -
- 2673246..2673309 - 64 NuclAT_44 - -
- 2673246..2673309 - 64 NuclAT_44 - -
- 2673246..2673309 - 64 NuclAT_44 - -
- 2673246..2673309 - 64 NuclAT_44 - -
- 2673246..2673309 - 64 NuclAT_47 - -
- 2673246..2673309 - 64 NuclAT_47 - -
- 2673246..2673309 - 64 NuclAT_47 - -
- 2673246..2673309 - 64 NuclAT_47 - -
- 2673246..2673309 - 64 NuclAT_50 - -
- 2673246..2673309 - 64 NuclAT_50 - -
- 2673246..2673309 - 64 NuclAT_50 - -
- 2673246..2673309 - 64 NuclAT_50 - -
- 2673247..2673309 - 63 NuclAT_52 - -
- 2673247..2673309 - 63 NuclAT_52 - -
- 2673247..2673309 - 63 NuclAT_52 - -
- 2673247..2673309 - 63 NuclAT_52 - -
- 2673248..2673309 - 62 NuclAT_17 - -
- 2673248..2673309 - 62 NuclAT_17 - -
- 2673248..2673309 - 62 NuclAT_17 - -
- 2673248..2673309 - 62 NuclAT_17 - -
- 2673248..2673309 - 62 NuclAT_20 - -
- 2673248..2673309 - 62 NuclAT_20 - -
- 2673248..2673309 - 62 NuclAT_20 - -
- 2673248..2673309 - 62 NuclAT_20 - -
- 2673248..2673309 - 62 NuclAT_23 - -
- 2673248..2673309 - 62 NuclAT_23 - -
- 2673248..2673309 - 62 NuclAT_23 - -
- 2673248..2673309 - 62 NuclAT_23 - -
- 2673248..2673309 - 62 NuclAT_26 - -
- 2673248..2673309 - 62 NuclAT_26 - -
- 2673248..2673309 - 62 NuclAT_26 - -
- 2673248..2673309 - 62 NuclAT_26 - -
- 2673248..2673309 - 62 NuclAT_29 - -
- 2673248..2673309 - 62 NuclAT_29 - -
- 2673248..2673309 - 62 NuclAT_29 - -
- 2673248..2673309 - 62 NuclAT_29 - -
- 2673248..2673309 - 62 NuclAT_32 - -
- 2673248..2673309 - 62 NuclAT_32 - -
- 2673248..2673309 - 62 NuclAT_32 - -
- 2673248..2673309 - 62 NuclAT_32 - -
KIM92_RS12925 2673362..2673469 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2673782..2673847 - 66 NuclAT_34 - -
- 2673782..2673847 - 66 NuclAT_34 - -
- 2673782..2673847 - 66 NuclAT_34 - -
- 2673782..2673847 - 66 NuclAT_34 - -
- 2673782..2673847 - 66 NuclAT_37 - -
- 2673782..2673847 - 66 NuclAT_37 - -
- 2673782..2673847 - 66 NuclAT_37 - -
- 2673782..2673847 - 66 NuclAT_37 - -
- 2673782..2673847 - 66 NuclAT_40 - -
- 2673782..2673847 - 66 NuclAT_40 - -
- 2673782..2673847 - 66 NuclAT_40 - -
- 2673782..2673847 - 66 NuclAT_40 - -
- 2673782..2673847 - 66 NuclAT_43 - -
- 2673782..2673847 - 66 NuclAT_43 - -
- 2673782..2673847 - 66 NuclAT_43 - -
- 2673782..2673847 - 66 NuclAT_43 - -
- 2673782..2673847 - 66 NuclAT_46 - -
- 2673782..2673847 - 66 NuclAT_46 - -
- 2673782..2673847 - 66 NuclAT_46 - -
- 2673782..2673847 - 66 NuclAT_46 - -
- 2673782..2673847 - 66 NuclAT_49 - -
- 2673782..2673847 - 66 NuclAT_49 - -
- 2673782..2673847 - 66 NuclAT_49 - -
- 2673782..2673847 - 66 NuclAT_49 - -
- 2673783..2673849 - 67 NuclAT_51 - -
- 2673783..2673849 - 67 NuclAT_51 - -
- 2673783..2673849 - 67 NuclAT_51 - -
- 2673783..2673849 - 67 NuclAT_51 - -
- 2673784..2673847 - 64 NuclAT_16 - -
- 2673784..2673847 - 64 NuclAT_16 - -
- 2673784..2673847 - 64 NuclAT_16 - -
- 2673784..2673847 - 64 NuclAT_16 - -
- 2673784..2673847 - 64 NuclAT_19 - -
- 2673784..2673847 - 64 NuclAT_19 - -
- 2673784..2673847 - 64 NuclAT_19 - -
- 2673784..2673847 - 64 NuclAT_19 - -
- 2673784..2673847 - 64 NuclAT_22 - -
- 2673784..2673847 - 64 NuclAT_22 - -
- 2673784..2673847 - 64 NuclAT_22 - -
- 2673784..2673847 - 64 NuclAT_22 - -
- 2673784..2673847 - 64 NuclAT_25 - -
- 2673784..2673847 - 64 NuclAT_25 - -
- 2673784..2673847 - 64 NuclAT_25 - -
- 2673784..2673847 - 64 NuclAT_25 - -
- 2673784..2673847 - 64 NuclAT_28 - -
- 2673784..2673847 - 64 NuclAT_28 - -
- 2673784..2673847 - 64 NuclAT_28 - -
- 2673784..2673847 - 64 NuclAT_28 - -
- 2673784..2673847 - 64 NuclAT_31 - -
- 2673784..2673847 - 64 NuclAT_31 - -
- 2673784..2673847 - 64 NuclAT_31 - -
- 2673784..2673847 - 64 NuclAT_31 - -
KIM92_RS12930 2673897..2674004 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
KIM92_RS12935 2674153..2675007 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KIM92_RS12940 2675043..2675852 - 810 WP_001257044.1 invasion regulator SirB1 -
KIM92_RS12945 2675856..2676248 - 393 WP_000200392.1 invasion regulator SirB2 -
KIM92_RS12950 2676245..2677078 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T202635 WP_000170965.1 NZ_CP074680:2672826-2672933 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T202635 NZ_CP099536:c82890-82423 [Pantoea ananatis]
TTGAAGCTCTATCGCATGACCAAAACGCGCTATCTGGGGTCGGCCTGGAGCGGTTTTGGTGCCCGCGAAGGCGGCGGGCG
CTGGAACAGCGTCGGCGTATCAATGGTTTACGCTTCTGAAACCGCTTCCCTCACCATGCTGGAGACGCTTATCCATCTGC
AAAGCGCCAGCGTGCTGGACTTTTTTACCCTCATGAGCATTGACGTTCCCGACAGGCTGATTGAATGGATCGATATCAAG
CAACTTCCTGACGACTGGGCCGCACCGGAAGCGCCTGCAGCGCTGCGTTTATTTGGTGATGCCTGGATACAAAGCGGGGG
ATCGGTCGCACTGCGCGTGCCCAGCGCCCTTTCGCCCGTAGAGTCGAATTATCTTCTCAATCCGGAACATCCCGAATTCA
ATGCTATCGTCAGACAGGCGGTAAACATCCCCTTCCTTTTTGACGTACGCTTCTCCCGACAGGCATAA

Antitoxin


Download         Length: 67 bp

>AT202635 NZ_CP074680:c2672779-2672713 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References