Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4629432..4629654 | Replicon | chromosome |
Accession | NZ_CP074576 | ||
Organism | Escherichia coli strain CS18F |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | KHZ70_RS22340 | Protein ID | WP_001295224.1 |
Coordinates | 4629547..4629654 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4629432..4629498 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KHZ70_RS22315 | 4624820..4625803 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
KHZ70_RS22320 | 4625800..4626804 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
KHZ70_RS22325 | 4626834..4628105 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
KHZ70_RS22330 | 4628581..4628688 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
KHZ70_RS22335 | 4629064..4629171 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4629432..4629498 | - | 67 | - | - | Antitoxin |
KHZ70_RS22340 | 4629547..4629654 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
KHZ70_RS22345 | 4630030..4630137 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
KHZ70_RS22350 | 4630224..4631903 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
KHZ70_RS22355 | 4631900..4632091 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
KHZ70_RS22360 | 4632088..4633659 | - | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
KHZ70_RS22365 | 4633932..4634120 | + | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T202440 WP_001295224.1 NZ_CP074576:4629547-4629654 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T202440 NZ_CP099390:3802642-3802860 [Citrobacter braakii]
ATGTCCGATAAACCATTAACTAAAACTGATTATTTGATGCGCCTGCGACGTTGTCAGACAATTGACACACTTGAGCGCGT
TATTGAAAAAAATAAATATGAATTGTCCGACAACGAACTGGCTGTATTTTACTCAGCAGCAGATCACCGCCTTGCTGAAT
TGACTATGAATAAGCTCTACGACAAGATTCCAACTTCTGTTTGGAAATTCATTCGCTAA
ATGTCCGATAAACCATTAACTAAAACTGATTATTTGATGCGCCTGCGACGTTGTCAGACAATTGACACACTTGAGCGCGT
TATTGAAAAAAATAAATATGAATTGTCCGACAACGAACTGGCTGTATTTTACTCAGCAGCAGATCACCGCCTTGCTGAAT
TGACTATGAATAAGCTCTACGACAAGATTCCAACTTCTGTTTGGAAATTCATTCGCTAA
Antitoxin
Download Length: 67 bp
>AT202440 NZ_CP074576:c4629498-4629432 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|