Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4628466..4628688 Replicon chromosome
Accession NZ_CP074576
Organism Escherichia coli strain CS18F

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag KHZ70_RS22330 Protein ID WP_000170738.1
Coordinates 4628581..4628688 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4628466..4628532 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KHZ70_RS22310 4623907..4624809 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
KHZ70_RS22315 4624820..4625803 + 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
KHZ70_RS22320 4625800..4626804 + 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -
KHZ70_RS22325 4626834..4628105 - 1272 WP_001318103.1 aromatic amino acid transport family protein -
- 4628466..4628532 - 67 - - Antitoxin
KHZ70_RS22330 4628581..4628688 + 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
KHZ70_RS22335 4629064..4629171 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
KHZ70_RS22340 4629547..4629654 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
KHZ70_RS22345 4630030..4630137 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
KHZ70_RS22350 4630224..4631903 - 1680 WP_001562264.1 cellulose biosynthesis protein BcsG -
KHZ70_RS22355 4631900..4632091 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
KHZ70_RS22360 4632088..4633659 - 1572 WP_001204944.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T202439 WP_000170738.1 NZ_CP074576:4628581-4628688 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T202439 NZ_CP099390:c2958917-2958814 [Citrobacter braakii]
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 67 bp

>AT202439 NZ_CP074576:c4628532-4628466 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References